DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and MEIS3

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_024307380.1 Gene:MEIS3 / 56917 HGNCID:29537 Length:509 Species:Homo sapiens


Alignment Length:201 Identity:53/201 - (26%)
Similarity:75/201 - (37%) Gaps:74/201 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RFHSDSSLDQDSLH-----------AVVGNDLSTEQG-------ANQVQNYHDMMVDSEHHVDIN 88
            |.|.||.    |:|           |....|.|::||       |:......|..:|.|..    
Human   293 RDHEDSG----SVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERR---- 349

  Fly    89 GSLRKRRGNLPKSSVKILKRWLYEH------------------------RY-------------- 115
              ..|:||..||.:..|::.||::|                        |:              
Human   350 --RNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQ 412

  Fly   116 --------NAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKK 172
                    :.|||:.:|..|:|:..||:|||.||||||||||:..||.:..........|..|:.
Human   413 SDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQP 477

  Fly   173 VVGATE 178
            :.|.||
Human   478 IGGYTE 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 22/84 (26%)
MEIS3XP_024307380.1 Meis_PKNOX_N 184..267 CDD:318653
Homeobox_KN 417..453 CDD:310480 18/35 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.