DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and PKNOX1

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_004562.2 Gene:PKNOX1 / 5316 HGNCID:9022 Length:436 Species:Homo sapiens


Alignment Length:85 Identity:37/85 - (43%)
Similarity:57/85 - (67%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLT 134
            |:|...|:.:   .|.| :||.:.:||.|||.:..:::.||::|..:.||::.||..::.:.|||
Human   242 QLQLNQDLSI---LHQD-DGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLT 302

  Fly   135 VLQVCNWFINARRRILPEMI 154
            :|||.|||||||||||..|:
Human   303 LLQVNNWFINARRRILQPML 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 20/38 (53%)
PKNOX1NP_004562.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Meis_PKNOX_N 80..165 CDD:406806
Homeobox_KN 277..316 CDD:399131 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152677
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.