DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Irx4

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_061373.1 Gene:Irx4 / 50916 MGIID:1355275 Length:515 Species:Mus musculus


Alignment Length:281 Identity:73/281 - (25%)
Similarity:106/281 - (37%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SEHHVDINGSLRK--RRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFI 143
            |::..|..|::..  ||.|..:.:...||.||.|||.|.||:..||..|:....:|:.||..||.
Mouse   131 SQYPYDRYGTVDSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFA 195

  Fly   144 NARRRILPEMIRREGNDPLHFTISRRG-----KKVVGATEEVDGAGEIHEGIANVLTNFEQYVQG 203
            |||||     :::|..    .|...|.     |:..|..|| :.|||            |:..:.
Mouse   196 NARRR-----LKKENK----MTWPPRNKCADEKRPYGEGEE-EEAGE------------EESREE 238

  Fly   204 P------NGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGG 262
            |      .|...|.:.|.|.|.:..:      :|:..::....|: |....:.:...|..|:..|
Mouse   239 PLKSAKSEGHAGKDDKELELSDLEDF------DPLDAETSECELK-TPFQSLDSGPERIPASSDG 296

  Fly   263 SAVGS----------GGAGGS--------SSNSSPATSILPYS-------------LFGQ--LPP 294
            ...|.          |.|||:        :.|...:|.::|.|             .|.|  .||
Mouse   297 PGTGKEASTTLRMPLGTAGGAVMDGDLERARNCLRSTVVVPDSGAEGGPPACEAKLTFAQAGAPP 361

  Fly   295 EFDDEEKPRPPKRVRTRTVAA 315
            ..  |.|||......|.|.||
Mouse   362 NL--ETKPRIWSLAHTATAAA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 19/38 (50%)
Irx4NP_061373.1 Homeobox_KN 161..200 CDD:368670 19/38 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..258 14/69 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..307 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.