DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and PBX1

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_005245285.1 Gene:PBX1 / 5087 HGNCID:8632 Length:486 Species:Homo sapiens


Alignment Length:384 Identity:77/384 - (20%)
Similarity:125/384 - (32%) Gaps:135/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVHASLLNNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRK 93
            || .:||..:.|.|..|...:::  :.:::....|:.|...:......:|:.....:|    .|:
Human   234 HV-MNLLREQSRTRPISPKEIER--MVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLD----ARR 291

  Fly    94 RRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREG 158
            :|.|..|.:.:||..:.|.|..|.|||:..|..|:::..:||.||.|||.|.|.|.         
Human   292 KRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRY--------- 347

  Fly   159 NDPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSW 223
                        ||.:|..:                                     |::.||:.
Human   348 ------------KKNIGKFQ-------------------------------------EEANIYAA 363

  Fly   224 QQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILPYSL 288
            :.|:.              ||.:                ||.||.....|:.||:.::|....|.
Human   364 KTAVT--------------ATNV----------------SAHGSQANSPSTPNSAGSSSSFNMSN 398

  Fly   289 FGQLPPEFDDEEKPRPPKRVRTRTVAAKSPRENAKQAKQKTGNKQ---ETMYCYKDSYGGIVVSP 350
            .|.|                   .::.:|...::.|..|...|.|   :|:.......||.    
Human   399 SGDL-------------------FMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGY---- 440

  Fly   351 RSEGEESAQGYESCGPNSEEEVRFETSHDWQSVIKTVFGTEEVSTSAGNNPGTSGSKAS 409
             |:|..::|.|...|        ...:..||...     |....||....||:..|..|
Human   441 -SDGLAASQMYSPQG--------ISANGGWQDAT-----TPSSVTSPTEGPGSVHSDTS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 17/38 (45%)
PBX1XP_005245285.1 PBC 40..288 CDD:281746 10/56 (18%)
homeodomain 290..350 CDD:238039 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.