DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and hth

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster


Alignment Length:115 Identity:43/115 - (37%)
Similarity:63/115 - (54%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSL-RKRRGNLPKSSVK 104
            |.|.:.:|  .|:.:|.:|:...|                .|...|.:|.. :|:||..||.:..
  Fly   332 DNFGTSAS--GDASNASIGSGEGT----------------GEEDDDASGKKNQKKRGIFPKVATN 378

  Fly   105 ILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMI 154
            ||:.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||
  Fly   379 ILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 21/38 (55%)
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.