DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and irx5b

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001001405.1 Gene:irx5b / 405792 ZFINID:ZDB-GENE-040628-5 Length:371 Species:Danio rerio


Alignment Length:237 Identity:56/237 - (23%)
Similarity:82/237 - (34%) Gaps:57/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE------- 152
            |.|..:.:...||.||.|||.|.||:..||..|:....:|:.||..||.|||||:..|       
Zfish   109 RKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTP 173

  Fly   153 -----------MIRREGND----PLHFTISRRGKKVVGATEEVDGAGEIHEG-----IANVLTNF 197
                       .|..|.||    |:         |...:|::.:...|.|:.     |.:.....
Zfish   174 RTRSEDEDEEDSIDLEKNDEDDEPM---------KTAESTKDSETRAEDHDDSTDSVIIDCGEEE 229

  Fly   198 EQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAI-- 260
            |...:.|.......:.|..:|.|         .|:......:|:..:...|.|.:.:.:.|..  
Zfish   230 ENRTESPVPTTSSPQDELSESTI---------KPLSGNCKPTSVIPSPNPKPKLWSLAEIATSDK 285

  Fly   261 GGSAVGSGGAGGSSSNSSPATSIL----------PYSLFGQL 292
            |...|......||...:.||..:.          .|..||.|
Zfish   286 GREEVSHTSRAGSPQCTFPARHLYYASPFFVGFSNYGAFGHL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 19/38 (50%)
irx5bNP_001001405.1 Homeobox_KN 123..162 CDD:283551 19/38 (50%)
IRO 267..284 CDD:214716 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.