DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Meis3

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_038937577.1 Gene:Meis3 / 361514 RGDID:1308532 Length:443 Species:Rattus norvegicus


Alignment Length:173 Identity:52/173 - (30%)
Similarity:78/173 - (45%) Gaps:28/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IKDLMHEAHVH--------ASLLNNEGRDRFHSDSSLDQDSLHAV-------VGNDLSTEQGANQ 70
            |:|......||        ..|.:..|      |:|.||....||       .|:.|.|...:  
  Rat   258 IRDHEDSGSVHLGTPGPSSGGLASQSG------DNSSDQVWCLAVQWGMCPSPGDGLDTSVAS-- 314

  Fly    71 VQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTV 135
                 ......:..:|:.....|:||..||.:..|::.||::|..:.|||:.:|..|:|:..||:
  Rat   315 -----PSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTI 374

  Fly   136 LQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVVGATE 178
            |||.||||||||||:..||.:........:.:..|:.:.|.||
  Rat   375 LQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGYTE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 21/38 (55%)
Meis3XP_038937577.1 Meis_PKNOX_N 99..234 CDD:406806
Homeobox_KN 348..387 CDD:399131 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346187
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.