DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and CG11617

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster


Alignment Length:187 Identity:47/187 - (25%)
Similarity:71/187 - (37%) Gaps:65/187 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISR 168
            ::||.||...|.|.|||..||..|:.|..||..|:||||.|.||::  :...||           
  Fly    41 RMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL--KNSERE----------- 92

  Fly   169 RGKKVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAI----AN 229
            :.||..|                :::.|   |.....|.:.:.....|||:   |::.:    |.
  Fly    93 KAKKSWG----------------HLIKN---YNHNARGNVEQFSISSEDSI---WEEEMHSCPAE 135

  Fly   230 NPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSN--SSPATSIL 284
            :..|..:...|..:|                        |:.|:::|  |||...||
  Fly   136 DDEGDDNEEFSSHST------------------------GSDGNANNEPSSPYKPIL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 20/38 (53%)
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.