DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Tgif1

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:310 Identity:104/310 - (33%)
Similarity:150/310 - (48%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRW 109
            |||. |:||:.:.:  |||:...:.:                     |:|||||||.||:||:.|
  Rat    28 SDSE-DEDSMDSPL--DLSSSAASGK---------------------RRRRGNLPKESVQILRDW 68

  Fly   110 LYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVV 174
            |||||||||||:.||..|||:.:|:.|||||||||||||:||:|:|::|.||..|||||||.|:.
  Rat    69 LYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKIS 133

  Fly   175 GATEEVDGAGEIHEGIANVLTNFEQ-----YVQGPN---GQMVKMEPEYEDSVIYSWQQAIANNP 231
            .|: .::.|    .||.|.:...|:     .|.|||   |:.|..:|.               :|
  Rat   134 EAS-SIEAA----MGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPP---------------SP 178

  Fly   232 MGFQSLHSSLQATMIDKIKN--YQMRKAAAIGGSAVGSGGAGGSSSNSS-----------PATSI 283
            ....:..|.:..|.:..:|:  :.:.:|.::|.|......|..:.:::|           |:.: 
  Rat   179 GPILARPSVICHTTVTALKDGPFSLCQAVSVGHSTDVQQVAPSNFTDASLRYPEDTCKSGPSPN- 242

  Fly   284 LPYSLFGQLPPEFDDEEKPRPPKRVRTRT-------VAAKSPRENAKQAK 326
             |.|.....||       |.||...:..:       ||.|...|...|||
  Rat   243 -PQSGLFNTPP-------PTPPDLNQDFSGFQLLVDVALKQAAEMELQAK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 29/38 (76%)
Tgif1NP_001015020.1 Homeobox_KN 68..107 CDD:283551 29/38 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346193
Domainoid 1 1.000 73 1.000 Domainoid score I9009
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8979
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.