DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Pbx3

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001101304.1 Gene:Pbx3 / 311876 RGDID:1307198 Length:434 Species:Rattus norvegicus


Alignment Length:288 Identity:65/288 - (22%)
Similarity:102/288 - (35%) Gaps:77/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVHASLLNNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRK 93
            || .:||..:.|.|..|...:::  :..::....|:.|...:......:|:.....:|    .|:
  Rat   180 HV-MNLLREQSRTRPISPKEIER--MVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLD----ARR 237

  Fly    94 RRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREG 158
            :|.|..|.:.:||..:.|.|..|.|||:..|..|:::.::||.||.|||.|.|.|.         
  Rat   238 KRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRY--------- 293

  Fly   159 NDPLHFTISRRGKKVVGATEE----------VDGAGEIHEGIANVLTNFEQYVQG--------PN 205
                        ||.:|..:|          |..|..:...:.|..||.......        ||
  Rat   294 ------------KKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPN 346

  Fly   206 -GQM-VKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSG 268
             |.| :.|:....||  |...|..||......:|...:..|                ||.:.|.|
  Rat   347 SGDMFMNMQSLNGDS--YQGSQVGANVQSQVDTLRHVINQT----------------GGYSDGLG 393

  Fly   269 -----------GAGGSSSNSSPATSILP 285
                       ..||....::|::...|
  Rat   394 ANSLYSPHNLNANGGWQDATTPSSVTSP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 17/38 (45%)
Pbx3NP_001101304.1 PBC 43..234 CDD:397732 10/56 (18%)
homeodomain 236..296 CDD:238039 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.