DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Meis2

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_038960864.1 Gene:Meis2 / 311311 RGDID:1305198 Length:496 Species:Rattus norvegicus


Alignment Length:262 Identity:74/262 - (28%)
Similarity:114/262 - (43%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNMVLDRHVRQNIKDLMHEAHVHASLLN----NEGRDRFHSDSSLDQDS--------LHAVVGND 61
            :::|:|.....:..|  || .:..|..|    |....|.|.|::....:        .||....|
  Rat   204 IDLVIDERDGSSKSD--HE-ELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 265

  Fly    62 LSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFT 126
            .|:|||.....:........:...|.:...:|:||..||.:..|::.||::|..:.|||:.:|..
  Rat   266 NSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQ 330

  Fly   127 LSQEANLTVLQVCNWFINARRRILPEMIRREGN-----DPLHFTISRRGKKVVGATEEVDGA--- 183
            |:|:..||:|||.||||||||||:..||.:...     ||   ::|:      ||....:|.   
  Rat   331 LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDP---SVSQ------GAAYSPEGQPMG 386

  Fly   184 -----GEIHEGI--ANVLTNFEQYVQ--GPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHS 239
                 |:.|.||  |.:.:....||.  ||.| |...:|.|....:......:.:.|    .:||
  Rat   387 SFVLDGQQHMGIRPAGLQSMPGDYVSQGGPVG-MGMAQPSYTPPQMTPHPTQLRHGP----PMHS 446

  Fly   240 SL 241
            .|
  Rat   447 YL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 21/38 (55%)
Meis2XP_038960864.1 Meis_PKNOX_N 129..213 CDD:406806 2/8 (25%)
Homeobox_KN 313..352 CDD:399131 21/38 (55%)
PAT1 <354..>482 CDD:401645 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.