DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and pbx4

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571522.1 Gene:pbx4 / 30728 ZFINID:ZDB-GENE-000201-18 Length:343 Species:Danio rerio


Alignment Length:120 Identity:35/120 - (29%)
Similarity:59/120 - (49%) Gaps:7/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HVHASLLNNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRK 93
            || .:||..:.|.|..|...:::  :.|::....|:.|...:......:|:.....:|    .|:
Zfish   176 HV-MNLLREQSRTRPISPKEIER--MVAIIHRKFSSIQMQLKQSTCEAVMILRSRFLD----ARR 233

  Fly    94 RRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 148
            :|.|..|.:.::|..:.|.|..|.|||:..|..|:::..:||.||.|||.|.|.|
Zfish   234 KRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 17/38 (45%)
pbx4NP_571522.1 PBC 39..230 CDD:281746 11/56 (20%)
homeodomain 232..292 CDD:238039 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.