DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Irx2

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001034594.1 Gene:Irx2 / 306657 RGDID:1309834 Length:474 Species:Rattus norvegicus


Alignment Length:343 Identity:78/343 - (22%)
Similarity:108/343 - (31%) Gaps:125/343 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGN 159
            |.|..:.:...||.||.|||.|.||:..||..|:....:|:.||..||.|||||     :::|..
  Rat   119 RKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKENK 178

  Fly   160 DPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQ 224
                .|.:.|.|     :|:.|.    .||.|:     ....:.|:......|...||..|    
  Rat   179 ----MTWAPRNK-----SEDEDE----DEGDAS-----RSKEENPDKAQDGTETSAEDEGI---- 221

  Fly   225 QAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSG-----GAGGSSSNSSPATSIL 284
                       |||       :|.:.::..        ||...|     .||.....|.....  
  Rat   222 -----------SLH-------VDSLTDHSC--------SAESDGEKLPCRAGDPLCESGSECK-- 258

  Fly   285 PYSLFGQLPPEFDDEEKPR----PPKRVRTRTVAAKSPRENAKQAKQKTGNKQETMYCYKDSYGG 345
              ..|..|..|.|||::..    |||.|.:..:.                              |
  Rat   259 --DKFEDLEDEEDDEDECERDLVPPKPVTSSPLT------------------------------G 291

  Fly   346 IVVSPRSEGEESAQGYESCGPNSEEEVRFETSHDWQSVIKTVFGTEEVSTSAGNNPGTSGSKASV 410
            :.....|...|:|....|.|                   ||..|:.   ||.|..|..|..|   
  Rat   292 VEAPLLSPAPEAAPRGGSGG-------------------KTPLGSR---TSPGAPPPASKPK--- 331

  Fly   411 QNTAIWNRNQTAKRDVNQ 428
                :|:..:.|..|:.|
  Rat   332 ----LWSLAEIATSDLKQ 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 19/38 (50%)
Irx2NP_001034594.1 COG5576 <115..217 CDD:227863 36/120 (30%)
Homeobox_KN 133..172 CDD:283551 19/38 (50%)
IRO 325..342 CDD:214716 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.