DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Tgif2

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_775572.1 Gene:Tgif2 / 228839 MGIID:1915299 Length:237 Species:Mus musculus


Alignment Length:93 Identity:61/93 - (65%)
Similarity:75/93 - (80%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFIN 144
            :.|..:.:.|. |||||||||.|||||:.|||.||||||||:.||.:||.:.||:|||:||||||
Mouse     8 EDEGLLSLTGK-RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFIN 71

  Fly   145 ARRRILPEMIRREGNDPLHFTISRRGKK 172
            ||||:||:|:|::|.||..|||||||.|
Mouse    72 ARRRLLPDMLRKDGKDPNQFTISRRGGK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 28/38 (74%)
Tgif2NP_775572.1 Homeobox_KN 36..75 CDD:368670 28/38 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 10/13 (77%)
Repressive function 103..237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..196
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842715
Domainoid 1 1.000 73 1.000 Domainoid score I9197
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8740
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.