DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Tgif1

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001157547.1 Gene:Tgif1 / 21815 MGIID:1194497 Length:305 Species:Mus musculus


Alignment Length:304 Identity:102/304 - (33%)
Similarity:145/304 - (47%) Gaps:69/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRW 109
            |||. |:||:.:.:  |||:...:.:                     |:|||||||.||:||:.|
Mouse    46 SDSE-DEDSMDSPL--DLSSSAASGK---------------------RRRRGNLPKESVQILRDW 86

  Fly   110 LYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVV 174
            |||||||||||:.||..|||:.:|:.|||||||||||||:||:|:|::|.||..|||||||.|:.
Mouse    87 LYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKIS 151

  Fly   175 GATEEVDGAGEIHEGIANVLTNFEQ-----YVQGPN---GQMVKMEPEYEDSVI-------YSWQ 224
            .|: .::.|    .||.|.:...|:     .|.|||   |:.|..:|....|::       ::..
Mouse   152 EAS-SIEAA----MGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTV 211

  Fly   225 QAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILPYSLF 289
            .|:.:.|..........|:|.:.:|........:.:...         .:..|.|:.:  |.|..
Mouse   212 TALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPE---------DTCKSGPSPN--PQSGL 265

  Fly   290 GQLPPEFDDEEKPRPPKRVRTRT-------VAAKSPRENAKQAK 326
            ...||       |.||...:..:       ||.|...|...|||
Mouse   266 FNTPP-------PTPPDLNQDFSGFQLLVDVALKRAAEMELQAK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 29/38 (76%)
Tgif1NP_001157547.1 Homeobox_KN 86..125 CDD:283551 29/38 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842727
Domainoid 1 1.000 73 1.000 Domainoid score I9197
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573375at2759
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 1 1.000 - - mtm8740
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 1 1.000 - - X2583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.