DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and unc-62

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001024169.1 Gene:unc-62 / 178845 WormBaseID:WBGene00006796 Length:564 Species:Caenorhabditis elegans


Alignment Length:291 Identity:62/291 - (21%)
Similarity:96/291 - (32%) Gaps:136/291 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HVRQNIKDLMHEAHVHASLL--NNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQNYHDMM 78
            |...|..|.:.||....|:.  |::|||...|||:                              
 Worm   351 HANGNSMDSISEAGDEFSVCGSNDDGRDSVLSDSA------------------------------ 385

  Fly    79 VDSEHHVDINGSLRKRRGNLP----KSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVC 139
                     |||...:| .:|    |.::...:.||:.:..:.|||:.:|..|::|..||:|||.
 Worm   386 ---------NGSQNGKR-KVPKVFSKEAITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVN 440

  Fly   140 NWFINARRRILPEMIRREGNDPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVLTNFEQYVQGP 204
            ||||||||||:..||.:.         :|.|:                                 
 Worm   441 NWFINARRRIVQPMIDQN---------NRAGR--------------------------------- 463

  Fly   205 NGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSGG 269
            :|||                                      :..||.:..::....|.:..||.
 Worm   464 SGQM--------------------------------------NVCKNRRRNRSEQSPGPSPDSGS 490

  Fly   270 AGGSSSNSSP----ATSILPYSLFGQLPPEF 296
            ..|::.:..|    |::.:||      |.||
 Worm   491 DSGANYSPDPSSLAASTAMPY------PAEF 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 20/38 (53%)
unc-62NP_001024169.1 Meis_PKNOX_N 133..218 CDD:293102
Homeobox_KN 410..449 CDD:283551 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.