DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and Meis3

DIOPT Version :10

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_036008636.1 Gene:Meis3 / 17537 MGIID:108519 Length:400 Species:Mus musculus


Alignment Length:154 Identity:51/154 - (33%)
Similarity:75/154 - (48%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RFHSDSSLDQDSLH-----------AVVGNDLSTEQGANQVQNYHDMMVDS------EHHVDING 89
            |.|.||.    |:|           |....|.|::||...     |..|.|      :..:|:..
Mouse   230 RDHEDSG----SVHLGTPGPSSGGLASQSGDNSSDQGDGL-----DTSVASPSSAGEDEDLDLER 285

  Fly    90 SLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMI 154
            ...|:||..||.:..|::.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||
Mouse   286 RRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 350

  Fly   155 RREGNDPLHFTISRRGKKVVGATE 178
            .:........:.:..|:.:.|.||
Mouse   351 DQSNRTGQGASFNPEGQPMAGFTE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 110..148 CDD:428673 20/37 (54%)
Meis3XP_036008636.1 Meis_PKNOX_N 99..205 CDD:465140
Homeobox_KN 306..344 CDD:428673 20/37 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.