Sequence 1: | NP_788337.1 | Gene: | vis / 36372 | FlyBaseID: | FBgn0033748 | Length: | 524 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291615.1 | Gene: | meis2a / 170454 | ZFINID: | ZDB-GENE-020122-2 | Length: | 409 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 59/196 - (30%) |
---|---|---|---|
Similarity: | 88/196 - (44%) | Gaps: | 38/196 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 NIKDLMHEAHVHASLLNNEGRDRFHSDSSLDQDSLH------------AVVGNDLSTEQGANQVQ 72
Fly 73 NYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQ 137
Fly 138 VCNWFINARRRILPEMIRREGN-----DPLHFTISRRGKKVVGATEEVDGA--------GEIHEG 189
Fly 190 I 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vis | NP_788337.1 | Homeobox_KN | 109..148 | CDD:283551 | 21/38 (55%) |
meis2a | XP_009291615.1 | Meis_PKNOX_N | 106..189 | CDD:293102 | |
Homeobox_KN | 302..341 | CDD:283551 | 21/38 (55%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170587152 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |