DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vis and meis2a

DIOPT Version :9

Sequence 1:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_009291615.1 Gene:meis2a / 170454 ZFINID:ZDB-GENE-020122-2 Length:409 Species:Danio rerio


Alignment Length:196 Identity:59/196 - (30%)
Similarity:88/196 - (44%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NIKDLMHEAHVHASLLNNEGRDRFHSDSSLDQDSLH------------AVVGNDLSTEQGANQVQ 72
            |:.|.|....:.:..|.|....|.|.|::    |.|            |....|.|:|||.....
Zfish   205 NLADHMGNGWIRSDRLQNPASWRDHDDAT----STHSAGTPGPSSGGLASQSGDNSSEQGDGLDN 265

  Fly    73 NYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQ 137
            :........:...|.:...:|:||..||.:..|::.||::|..:.|||:.:|..|:|:..||:||
Zfish   266 SVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQ 330

  Fly   138 VCNWFINARRRILPEMIRREGN-----DPLHFTISRRGKKVVGATEEVDGA--------GEIHEG 189
            |.||||||||||:..||.:...     ||   ::|:      ||....:|.        |:.|.|
Zfish   331 VNNWFINARRRIVQPMIDQSNRAGFLLDP---SVSQ------GAAYSPEGQPMGSFVLDGQQHMG 386

  Fly   190 I 190
            |
Zfish   387 I 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 21/38 (55%)
meis2aXP_009291615.1 Meis_PKNOX_N 106..189 CDD:293102
Homeobox_KN 302..341 CDD:283551 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.