DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and CG42402

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001287642.1 Gene:CG42402 / 7354470 FlyBaseID:FBgn0259821 Length:747 Species:Drosophila melanogaster


Alignment Length:89 Identity:24/89 - (26%)
Similarity:35/89 - (39%) Gaps:27/89 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 REEEQASLEALASG---GKRILQCPSS------------FDSVLCWPRTNAGSL-------AVLP 106
            |.|.:...:.|..|   |...|:.|||            ..||   |..|:.|.       :|.|
  Fly   102 RSEIRGRTKHLLRGSIFGSPPLKTPSSKYMTAGHSLAVPVQSV---PEFNSSSATSSESISSVSP 163

  Fly   107 CFEEFKGVHYDTTDNATRFC-FPN 129
            ..::.:...|: ||||:..| :||
  Fly   164 SVDDIQSTDYN-TDNASENCMWPN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 19/68 (28%)
7tm_2 159..407 CDD:278432
CG42402NP_001287642.1 Gal_Lectin <181..259 CDD:280328 3/6 (50%)
Gal_Lectin 277..359 CDD:280328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.