DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and CG42402

DIOPT Version :10

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001287642.1 Gene:CG42402 / 7354470 FlyBaseID:FBgn0259821 Length:747 Species:Drosophila melanogaster


Alignment Length:89 Identity:24/89 - (26%)
Similarity:35/89 - (39%) Gaps:27/89 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 REEEQASLEALASG---GKRILQCPSS------------FDSVLCWPRTNAGSL-------AVLP 106
            |.|.:...:.|..|   |...|:.|||            ..||   |..|:.|.       :|.|
  Fly   102 RSEIRGRTKHLLRGSIFGSPPLKTPSSKYMTAGHSLAVPVQSV---PEFNSSSATSSESISSVSP 163

  Fly   107 CFEEFKGVHYDTTDNATRFC-FPN 129
            ..::.:...|: ||||:..| :||
  Fly   164 SVDDIQSTDYN-TDNASENCMWPN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:397086 19/68 (28%)
7tmB1_DH_R 158..428 CDD:320391
TM helix 1 160..185 CDD:320391
TM helix 2 194..216 CDD:320391
TM helix 3 230..257 CDD:320391
TM helix 4 269..289 CDD:320391
TM helix 5 314..343 CDD:320391
TM helix 6 357..384 CDD:320391
TM helix 7 390..415 CDD:320391
CG42402NP_001287642.1 Gal_Rha_Lectin 51..261 CDD:459238 24/89 (27%)
Gal_Rha_Lectin_EVA1_EVA1C_rpt2 264..361 CDD:438686
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.