DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and zgc:64002

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001104716.2 Gene:zgc:64002 / 393330 ZFINID:ZDB-GENE-040426-1329 Length:262 Species:Danio rerio


Alignment Length:227 Identity:45/227 - (19%)
Similarity:66/227 - (29%) Gaps:83/227 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 FQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYA-------------------LIGW---- 277
            |..|.|..|..:|..|.:....::...|..:|..:|.|                   :..|    
Zfish    39 FLTFVLGVFSRLFSTGKHRGQRLIDVGSGPSIHCVISACAHYDEILLSDFSDNNRREIEKWLKNQ 103

  Fly   278 -GCPAVCILVWSIAKAFAPHLENEHFNGLE----------IDCAWMRESHIDWIFKVPASLALLV 331
             ||     |.||.........|.:..:.||          :.|....|:..|.:...||.     
Zfish   104 EGC-----LDWSPILQHVSKTEGKRPSDLEATLKQRIKKVLKCDVRLENPFDPLTLEPAD----- 158

  Fly   332 NLVFLIRIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFGITYLL----------VLTGPEQG 386
                      .:||.|......:..|.|:.:        |.|:|.||          ||:.....
Zfish   159 ----------CVITSLCLEAACKDMQIYRQA--------LHGLTKLLCPGGLFVMVGVLSETFYK 205

  Fly   387 ISRNLF-----------EAIRAFLISTQGFFV 407
            :...||           ||::.|..|.|.|.|
Zfish   206 VDEQLFSCLSLKQNDIEEALKGFGFSIQEFNV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888
7tm_2 159..407 CDD:278432 44/225 (20%)
zgc:64002NP_001104716.2 AdoMet_MTases 2..260 CDD:302624 45/227 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.