DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and mthl10

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster


Alignment Length:336 Identity:72/336 - (21%)
Similarity:130/336 - (38%) Gaps:65/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 YAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTL-FLQVITTESSQAG 228
            ||..:.:.|..|.:|  ::|...:||    ..|....:.|:....:...:| ::|:...:::...
  Fly   251 YAMMFSIPFMMLTIA--VYLLIPELR----NQHGKSLVCYLIGLSVGYSSLCYVQLYQVDATGVT 309

  Fly   229 CITLVIMFQYFYLTNFFWMFVEGLYLY-----TLVVQTFSSDNISFIIYALIGWGCPAVCILVWS 288
            |........:|::..:.|:.|....|:     |..:..| .:...|:.|:|..||...|.:    
  Fly   310 CKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRF-QEKKRFLFYSLYSWGIALVFL---- 369

  Fly   289 IAKAF---APHLENEHFN-----GLEIDCAWMRESHIDW----IFKVPASLALLVNLVFLI---- 337
               ||   |..|.|...|     |..:.| |:..|  :|    .|..|....::.|.:..|    
  Fly   370 ---AFTYCAQQLTNLPANLKPGIGDGVYC-WLDMS--NWAAMIYFYGPILAIVVANTIMFIMTAI 428

  Fly   338 ------RIMWVLITKLRSAHTLET---RQYYKASK-----ALLVLIPLFGITYLLVL----TGPE 384
                  |.|..:|....|...|.|   :::|:|..     ..|.|..:.|||:|..|    .|.:
  Fly   429 KIHGVQREMARIIASENSTKNLRTEKDKRFYRAWSNYRFGLFLRLFLIMGITWLTELISYFVGSD 493

  Fly   385 QGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIHRNSSIKNRSTEEC 449
            :|.|:..:  |.....:.|||.:.:.: .:..:|:..:.:..:..|:..| .|.|....::|...
  Fly   494 KGWSKLFY--ISDLANAMQGFLIFMLF-VMKKKVKHLITNRCSSVRDGSN-QRQSQYSTKTTSSS 554

  Fly   450 VICL----RPS 456
            |..|    :||
  Fly   555 VANLSLHEKPS 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888
7tm_2 159..407 CDD:278432 62/281 (22%)
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145
7tm_4 244..514 CDD:304433 62/281 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.