DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and mthl9

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_612029.1 Gene:mthl9 / 38056 FlyBaseID:FBgn0035131 Length:513 Species:Drosophila melanogaster


Alignment Length:248 Identity:52/248 - (20%)
Similarity:93/248 - (37%) Gaps:63/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 LRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFW---MFVEGLY 253
            :|.:.|..  |||....:..:......|:.||   .||....:..::    :.||   :|..|  
  Fly   113 VRESTHVE--LTYANRTVDQVRIRDRFVVRTE---LGCRNKFVDKKH----DNFWQWDLFENG-- 166

  Fly   254 LYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAK-AFAPHLEN-EHFNGLEIDCAWMRESH 316
                   |...||                  .:||..: .|:|...| |.:....::|...:..:
  Fly   167 -------TLRRDN------------------RLWSTDEYCFSPLEHNPEQWELTPLNCERFQTGY 206

  Fly   317 IDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFGITYLLVLT 381
            ..||:.:.:.:|:::| :|::.::. .:...|.:|..:...||     ||.:|..:.:...|.|.
  Fly   207 RVWIYAICSIIAIIIN-IFILSLLG-SVRDARKSHYGQLIIYY-----LLSMIVGYSLLVYLALK 264

  Fly   382 GP---EQGISRNL-FEAIRAFLISTQGFFVALFYC-------FLNSEVRQTLR 423
            .|   .....||: |.|....::|    ||.|..|       |....||.::|
  Fly   265 NPMKLSHVACRNIGFLAYFCIMLS----FVFLAICSLDFLLKFKQKAVRSSVR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888
7tm_2 159..407 CDD:278432 44/223 (20%)
mthl9NP_612029.1 Methuselah_N 29..199 CDD:284145 23/121 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.