DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and mthl8

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster


Alignment Length:415 Identity:77/415 - (18%)
Similarity:135/415 - (32%) Gaps:133/415 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LASGGKRILQCPSSFDSVLCWPRTNAGSLAV-LPCFEEFKG-------VHYDTTDNAT------- 123
            |.:|..|:::....|            |:.| .|| |..|.       ||:...:|.|       
  Fly   127 LGNGSLRLVKLQPRF------------SIHVETPC-EHMKAVTKGSEYVHWTLHENGTISHRGHI 178

  Fly   124 ---RFCFP-----NGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAII----------YAGGYF 170
               .:||.     |.||                    ::.|....|..:          ||....
  Fly   179 FSKHYCFTPLLHGNSTW--------------------EWQPLACAPEKLYFVLGVREWTYAICLL 223

  Fly   171 LSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIM 235
            ::..::.:.|:::|...:   :||:.:......|   |:..||...|....|..:.|.       
  Fly   224 IAILSMFIVLMVYLMCSE---MRNSFYGVAIKAY---AICMILGYALLAYLTLHNPAN------- 275

  Fly   236 FQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIY---------ALIGW--GCPAVCILV-WS 288
                 |:|.....:..|.|..||:..:....|:|.:|         .|:.|  ..|.|.:.| ||
  Fly   276 -----LSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLMFWLIFTPIVLVAVGWS 335

  Fly   289 IAKAFAPHLENEHFNGLEIDCAWM--RESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAH 351
            ....|:.:.....|.|   |..|.  |...:...|..|..:|..::..|.: :..:.|   |...
  Fly   336 FFVGFSYYGSRLIFGG---DTCWFDPRNWSVMIYFYAPVFVACAISGFFYV-LSQIYI---RDQP 393

  Fly   352 TLETRQYYKA----------------SKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLI 400
            .:||.:.:::                :...:|.|..|...|...        :|:......:|.:
  Fly   394 DIETEKSFESIEKNRFKSFWKYFGYTAVVWVVCICSFAFNYYWE--------NRSHLNYAVSFCM 450

  Fly   401 STQGFFVALFYCFL--NSEVRQTLR 423
            :..||  |..|..:  |.:::..||
  Fly   451 AFHGF--AALYALIGKNQQIQNFLR 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 16/84 (19%)
7tm_2 159..407 CDD:278432 52/287 (18%)
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 20/107 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.