DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dh44-R2 and Fbxo46

DIOPT Version :9

Sequence 1:	NP_610789.3	Gene:	Dh44-R2 / 36368	FlyBaseID:	FBgn0033744	Length:	476	Species:	Drosophila melanogaster
Sequence 2:	NP_001020813.1	Gene:	Fbxo46 / 292686	RGDID:	1308393	Length:	603	Species:	Rattus norvegicus

Alignment Length:	129	Identity:	27/129 - (20%)
Similarity:	39/129 - (30%)	Gaps:	51/129 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 DDLRALVDSLDDASQEDLAKVIANFSVDMLQRAS-----ALIGAQQGS----------SGGQLQN 53
            ||    ||.|..|....|.:..|..::....|.|     ..:.|:||.          |||...:
  Rat   165 DD----VDLLSVAEMVALVEQRAALALQSYPRPSTPAPVVFVSAEQGGPAKGLGSERRSGGGDCS 225

  Fly    54 RTLQ--CQQQQQRE------------------------------EEQASLEALASGGKRILQCP 85
            |..:  ...:.||:                              |.|:...:||:||.....||
  Rat   226 RVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNVREPQSPDGSLANGGGGRPACP 289

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dh44-R2	NP_610789.3	HRM	82..144	CDD:280888	2/4 (50%)
Dh44-R2	NP_610789.3	7tm_2	159..407	CDD:278432
Fbxo46	NP_001020813.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	20..55
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	111..163
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	235..301		10/55 (18%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	332..359
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	396..442
		F-box-like	473..>507	CDD:403981
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4564
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900