DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and Gipr

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_036846.1 Gene:Gipr / 25024 RGDID:2689 Length:455 Species:Rattus norvegicus


Alignment Length:462 Identity:141/462 - (30%)
Similarity:204/462 - (44%) Gaps:85/462 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LQRASALIGAQQGSSGGQLQNRTLQCQQQQQREEEQASLEAL--ASGGKRILQCPSSFDSVLCWP 95
            ||||..   ..:|.:.|:|..|     .::...|.|.:|||.  .||    |.|..|||...||.
  Rat    17 LQRAET---DSEGQTTGELYQR-----WERYGWECQNTLEATEPPSG----LACNGSFDMYACWN 69

  Fly    96 RTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVEL 160
            .|.|.:.|.:.|................|.|..:|.|..:.|:.:| :|........|....:|.
  Rat    70 YTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQC-ENPEKNGAFQDQKLILER 133

  Fly   161 PAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSA--------LLWIL---- 213
            ..::|..||.||.|||::||:|...|:.|.|.||.||.|||.:::..|        ||..|    
  Rat   134 LQVVYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHMNLFTSFMLRAGAILTRDQLLPPLGPYT 198

  Fly   214 -----TLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYA 273
                 ||:.|.:      |.|.|..|:.||....|:.|:.|||:||:.|:|....|:...|..|.
  Rat   199 GNQTPTLWNQAL------AACRTAQILTQYCVGANYTWLLVEGVYLHHLLVVVRRSEKGHFRCYL 257

  Fly   274 LIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIR 338
            |:|||.||:.::.|.|.:....:.:....|  |:...|       ||.:.|..:.:|:|.:..||
  Rat   258 LLGWGAPALFVIPWVIVRYLYENTQCWERN--EVKAIW-------WIIRTPILITILINFLIFIR 313

  Fly   339 IMWVLITKLRSAHTLETRQY------YKASKALLVLIPLFG---ITYLLVLTGPEQGISRNLFEA 394
            |:.:|::|||      |||.      .:.:::.|.|:||.|   :.:..|.....:|..|....|
  Rat   314 ILGILVSKLR------TRQMRCPDYRLRLARSTLTLMPLLGVHEVVFAPVTEEQAEGSLRFAKLA 372

  Fly   395 IRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIHRNSSIKNRSTEECVICLRPSPHT 459
            ...||.|.|||.|::.|||:|.||:..:|    |.|.|..            |:|     |.|| 
  Rat   373 FEIFLSSFQGFLVSVLYCFINKEVQSEIR----RLRLSLQ------------EQC-----PRPH- 415

  Fly   460 RLGSLQR 466
             ||...|
  Rat   416 -LGQAPR 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 17/61 (28%)
7tm_2 159..407 CDD:278432 88/273 (32%)
GiprNP_036846.1 HRM 55..118 CDD:280888 18/67 (27%)
7tm_2 131..385 CDD:278432 88/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X66
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.