DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and Vipr2

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_033537.1 Gene:Vipr2 / 22355 MGIID:107166 Length:437 Species:Mus musculus


Alignment Length:424 Identity:131/424 - (30%)
Similarity:200/424 - (47%) Gaps:54/424 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 REEEQASLEALASGGKRILQCPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFP 128
            :|||....|.|:|..:....|...:|::.||...:.|....:||.:.|.. .|....|.::.|..
Mouse    31 QEEETKCAELLSSQTENQRACSGVWDNITCWRPADVGETVTVPCPKVFSN-FYSRPGNISKNCTS 94

  Fly   129 NGTWDHYSDY-DRCHQNSGSIPVVPDFSPNVE---LPAIIYAGGYFLSFATLVVALIIFLSFKDL 189
            :|..:.:.|: |.|..|.      |:....:.   |...||..||.:|..:|....||...|:.|
Mouse    95 DGWSETFPDFIDACGYND------PEDESKISFYILVKAIYTLGYSVSLMSLTTGSIIICLFRKL 153

  Fly   190 RCLRNTIHANLFLTYITSAL--------LWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFW 246
            .|.||.||.||||:::..|:        |:..:..|:.....:|..||...::.|||..:.||:|
Mouse   154 HCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGLLRCHDQPASWVGCKLSLVFFQYCIMANFYW 218

  Fly   247 MFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAW 311
            :.||||||:||:|....... .|:.|.|||||.|:|||..|:..:.           .||....|
Mouse   219 LLVEGLYLHTLLVAILPPSR-CFLAYLLIGWGIPSVCIGAWTATRL-----------SLEDTGCW 271

  Fly   312 MRESHID--WIFKVPASLALLVNLVFLIRIMWVLITKLRSAHT--LETRQYYKASKALLVLIPLF 372
            ....|..  |:.::|..::::||....|.|:.:|:.||.|...  .:..||.:.:|:.|:|||||
Mouse   272 DTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLF 336

  Fly   373 GITYLLVLTGPEQGISRN---LFE-AIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWR--- 430
            |:.|::....| .|||..   ||| .:.:|    ||..||:.||||||||:..|:.   |||   
Mouse   337 GVHYMVFAAFP-IGISSTYQILFELCVGSF----QGLVVAVLYCFLNSEVQCELKR---RWRGLC 393

  Fly   431 ----ESRNIHRNSSIKNRSTEECVICLRPSPHTR 460
                .||:...:|...:|:..|..:.:.....|:
Mouse   394 LTQAGSRDYRLHSWSMSRNGSESALQIHRGSRTQ 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 15/62 (24%)
7tm_2 159..407 CDD:278432 88/266 (33%)
Vipr2NP_033537.1 HormR 47..117 CDD:214468 17/76 (22%)
7tm_2 122..370 CDD:278432 88/264 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.