DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R2 and anmt-2

DIOPT Version :9

Sequence 1:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_498334.1 Gene:anmt-2 / 175868 WormBaseID:WBGene00018340 Length:274 Species:Caenorhabditis elegans


Alignment Length:41 Identity:13/41 - (31%)
Similarity:20/41 - (48%) Gaps:5/41 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 AVCILVWSIAKAFAPHLENEHFNGLEIDCAWMR-ESHIDWI 320
            |:|..  .:||..  ||.:.....|::...|:| |..|||:
 Worm    86 ALCFR--DVAKRV--HLSDFVDRNLDVLRKWIRHEETIDWV 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888
7tm_2 159..407 CDD:278432 13/41 (32%)
anmt-2NP_498334.1 NNMT_PNMT_TEMT 13..273 CDD:250464 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.