powered by:
Protein Alignment Dh44-R2 and anmt-2
DIOPT Version :9
Sequence 1: | NP_610789.3 |
Gene: | Dh44-R2 / 36368 |
FlyBaseID: | FBgn0033744 |
Length: | 476 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498334.1 |
Gene: | anmt-2 / 175868 |
WormBaseID: | WBGene00018340 |
Length: | 274 |
Species: | Caenorhabditis elegans |
Alignment Length: | 41 |
Identity: | 13/41 - (31%) |
Similarity: | 20/41 - (48%) |
Gaps: | 5/41 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 281 AVCILVWSIAKAFAPHLENEHFNGLEIDCAWMR-ESHIDWI 320
|:|.. .:||.. ||.:.....|::...|:| |..|||:
Worm 86 ALCFR--DVAKRV--HLSDFVDRNLDVLRKWIRHEETIDWV 122
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Dh44-R2 | NP_610789.3 |
HRM |
82..144 |
CDD:280888 |
|
7tm_2 |
159..407 |
CDD:278432 |
13/41 (32%) |
anmt-2 | NP_498334.1 |
NNMT_PNMT_TEMT |
13..273 |
CDD:250464 |
13/41 (32%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4564 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.