DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8545 and AT4G17590

DIOPT Version :9

Sequence 1:NP_610786.2 Gene:CG8545 / 36365 FlyBaseID:FBgn0033741 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_193494.4 Gene:AT4G17590 / 827478 AraportID:AT4G17590 Length:201 Species:Arabidopsis thaliana


Alignment Length:144 Identity:43/144 - (29%)
Similarity:68/144 - (47%) Gaps:43/144 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 VPLGATPEYLAGHYMIQGASSLLPVMALAPQENERILDMCSAPGGKGSHIASIMKNTGVLFANDS 468
            :|:|.|||:|:|.:|                                     ::|  |::|||.|
plant    37 LPIGETPEHLSGRFM-------------------------------------VIK--GIIFANAS 62

  Fly   469 NRDRIKAIVANFHRLGIVNAVVSCED-GTKFRNI--MTGFDRVLLDAPCTGTGVVSKDPSVK-TT 529
            ....:.::.||.||:||.|.|||..: .||...:  :...|.||::||.|.||::|:..|:| :.
plant    63 TEHLLGSLYANLHRMGITNTVVSNYNINTKLSRVFHINSKDMVLVNAPSTRTGLISEFGSIKMSI 127

  Fly   530 KSEVDVQRCYNLQR 543
            ..|.|:||...||:
plant   128 NEEADIQRFGVLQK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8545NP_610786.2 Methyltr_RsmF_N 333..424 CDD:293730 8/19 (42%)
nop2p 363..637 CDD:188051 43/144 (30%)
Nol1_Nop2_Fmu 428..636 CDD:279522 35/120 (29%)
AT4G17590NP_193494.4 AdoMet_MTases 38..>141 CDD:302624 42/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.