DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8545 and NSUN6

DIOPT Version :9

Sequence 1:NP_610786.2 Gene:CG8545 / 36365 FlyBaseID:FBgn0033741 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_011517685.1 Gene:NSUN6 / 221078 HGNCID:23529 Length:472 Species:Homo sapiens


Alignment Length:457 Identity:118/457 - (25%)
Similarity:175/457 - (38%) Gaps:146/457 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 MLETVDKQDVFQLPVEGEETEKDLTLQEVQ----------------------------QRIKDVS 298
            :|:..|.|||..:||.|  ..|::..|:.:                            .:..||.
Human    85 ILQHPDLQDVLLIPVIG--PRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVI 147

  Fly   299 LVLSDF-----KRYRQADRSRGEYIDLLRRDLCLYYSYNEFLMEKLMDMLPLTELMEYLEASEIA 358
            .|.||.     |..::.|.::          :.|....:|...:::...||        |...:.
Human   148 SVYSDIKGKCKKGAKEFDGTK----------VFLGNGISELSRKEIFSGLP--------ELKYVI 194

  Fly   359 RPLTIRTNTLKTRRRDLAGALINRGVNLDPLGKWTKVGLVVFNSQVPLGATPEYLAGHYMIQGAS 423
            |.:.||               :...|.|.|          .|:|     ..|.||    .:|...
Human   195 RGMGIR---------------MTEPVYLSP----------SFDS-----VLPRYL----FLQNLP 225

  Fly   424 SLLPVMALAPQENERILDMCSAPGGKGSHIASIMKNTGVLFANDSNRDRIKAIVANFHRLGIVNA 488
            |.|....|.||..|:|||:|:|||||.:|||::|.:.|.:.|.|...::::.|..|...||:.:.
Human   226 SALVSHVLNPQPGEKILDLCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNALLLGLNSI 290

  Fly   489 VVSCEDGTKFRN-------------IMTGFDRVLLDAPCTGTGVVSKDPSVKTTKSEVDVQRCYN 540
            ...|.||||...             :...|||:||||||:|.|   :.|::..|.|..:|.....
Human   291 RAFCFDGTKAVKLDMVEDTEGEPPFLPESFDRILLDAPCSGMG---QRPNMACTWSVKEVASYQP 352

  Fly   541 LQRKLLLTAIDCTDAKSSTGGYIVYSTCSVLPEENEWVIDYALKK-RNVKLVPTGLDFGVEGF-- 602
            |||||...|:.....:    |.:|||||::...|||..:.:||.| ..::|.|.....|.||.  
Human   353 LQRKLFTAAVQLLKPE----GVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGEGMRG 413

  Fly   603 -----TKFRQ-HRFHPS--------------------LNLTKRYYPHTHNMD--GFYVAKLKKFS 639
                 .:.:| .||.||                    |.|.        |.|  ||::||..|..
Human   414 AGLSCEQLKQLQRFDPSAVPLPDTDMDSLREARREDMLRLA--------NKDSIGFFIAKFVKCK 470

  Fly   640 NT 641
            :|
Human   471 ST 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8545NP_610786.2 Methyltr_RsmF_N 333..424 CDD:293730 16/90 (18%)
nop2p 363..637 CDD:188051 93/317 (29%)
Nol1_Nop2_Fmu 428..636 CDD:279522 80/251 (32%)
NSUN6XP_011517685.1 PUA 114..205 CDD:214635 15/123 (12%)
RsmB <218..468 CDD:223222 85/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.