DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and Igsf9

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001139272.1 Gene:Igsf9 / 93842 MGIID:2135283 Length:1179 Species:Mus musculus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:109/281 - (38%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PVFLSTGSTLVIKDSRFSLRYDPN-------SSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAE 126
            |:|:..|        .:|.|.||:       .:...|||:.::..|.|.|.|:|:....|....:
Mouse    65 PIFIQFG--------LYSPRIDPDYVGRVRLQTGASLQIEGLRVEDQGWYECRVLFLDQHSPEQD 121

  Fly   127 ------VKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYV 185
                  |.|:|..||...:.....:...|...|.:.|.|.|.|.|.:||:.....:........|
Mouse   122 FANGSWVHLTVNSPPQFQETPPLVLEVKELEAVTLRCVARGSPQPYVTWKFRGQDLGKGQGQVQV 186

  Fly   186 GN-TLRIKSVKKEDRGTYYCVADNGVSKGD-RRNINVEVEFAPVITVPRPRLGQALQYDMDLECH 248
            .| ||.|:.|::...|.|.|.|.:  |:|. .....:.|...|||.||..........|:.|.|.
Mouse   187 QNGTLWIRRVERGSAGDYTCQASS--SEGSITHATQLLVLGPPVIVVPPSNSTVNSSQDVSLACR 249

  Fly   249 IEAYPPP-AIVWTKDDIQLANNQHYSISHFATADE-YTDSTLRVITVEKRQYGDYVCKATNRF-- 309
            .||||.. ...|.:|.:.:     :.||...:... ..|.:|.:...:....|.|.|..:|.|  
Mouse   250 AEAYPANLTYSWFQDGVNV-----FHISRLQSRVRILVDGSLWLQATQPDDAGHYTCVPSNGFLH 309

  Fly   310 -GEAEARVN-LFETIIPVCPP 328
             ..|.|.:. |:...:.|.||
Mouse   310 PPSASAYLTVLYPAQVTVMPP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 18/74 (24%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353 3/11 (27%)
Ig strand C' 68..72 CDD:409353 1/2 (50%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 11/37 (30%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 1/11 (9%)
Ig strand G 124..130 CDD:409353 1/11 (9%)
Ig_3 134..208 CDD:404760 21/74 (28%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 3/4 (75%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 24/96 (25%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Igsf9NP_001139272.1 IG_like 28..110 CDD:214653 14/52 (27%)
Ig 136..223 CDD:386229 22/88 (25%)
Ig_3 227..305 CDD:372822 21/82 (26%)
Ig 341..404 CDD:386229
Ig 436..500 CDD:319273
FN3 508..599 CDD:238020
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..974
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11062
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.