Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139272.1 | Gene: | Igsf9 / 93842 | MGIID: | 2135283 | Length: | 1179 | Species: | Mus musculus |
Alignment Length: | 281 | Identity: | 72/281 - (25%) |
---|---|---|---|
Similarity: | 109/281 - (38%) | Gaps: | 36/281 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 PVFLSTGSTLVIKDSRFSLRYDPN-------SSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAE 126
Fly 127 ------VKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYV 185
Fly 186 GN-TLRIKSVKKEDRGTYYCVADNGVSKGD-RRNINVEVEFAPVITVPRPRLGQALQYDMDLECH 248
Fly 249 IEAYPPP-AIVWTKDDIQLANNQHYSISHFATADE-YTDSTLRVITVEKRQYGDYVCKATNRF-- 309
Fly 310 -GEAEARVN-LFETIIPVCPP 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 18/74 (24%) |
FR1 | 37..50 | CDD:409353 | |||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | |||
CDR1 | 51..59 | CDD:409353 | |||
Ig strand C | 59..63 | CDD:409353 | |||
FR2 | 60..63 | CDD:409353 | |||
CDR2 | 67..81 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 68..72 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 11/37 (30%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 1/11 (9%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/11 (9%) | ||
Ig_3 | 134..208 | CDD:404760 | 21/74 (28%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 3/4 (75%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 24/96 (25%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
Igsf9 | NP_001139272.1 | IG_like | 28..110 | CDD:214653 | 14/52 (27%) |
Ig | 136..223 | CDD:386229 | 22/88 (25%) | ||
Ig_3 | 227..305 | CDD:372822 | 21/82 (26%) | ||
Ig | 341..404 | CDD:386229 | |||
Ig | 436..500 | CDD:319273 | |||
FN3 | 508..599 | CDD:238020 | |||
FN3 | 625..715 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 767..807 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 819..842 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 942..974 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1016..1079 | ||||
PDZ-binding | 1177..1179 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 55 | 1.000 | Domainoid score | I11062 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |