DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and PAPLN

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:338 Identity:83/338 - (24%)
Similarity:123/338 - (36%) Gaps:87/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQET 106
            :|..|...||...|.|....:.| |..|          |...|..|::|.:     |.|..:|..
Human   923 LGQLVRLSCSDDTAPESQAAWQK-DGQP----------ISSDRHRLQFDGS-----LIIHPLQAE 971

  Fly   107 DAGTYTC------------QV-VISTVHKVSAEVKLS---VRRPPV------------------- 136
            |||||:|            |: :|.....|.:|.:||   ..|.|.                   
Human   972 DAGTYSC
GSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIPSSH 1036

  Fly   137 --------ISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKS 193
                    :..|..:.|.||.|..::|.|.|.|:|.|.|.|:|:...:...........:|.|..
Human  1037 PQPANRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDGSLVISR 1101

  Fly   194 VKKEDRGTYYCVADNGVSKGDRRNINVEV-------EFAPVITVPRPRLGQALQYDMDLECHIEA 251
            |..||.|.|.|||.||..: |:|.:.:.|       ...|.:|||.....:.|       | :.|
Human  1102 VAVEDGGFYTCVAFNGQDR-DQRWVQLRVLGELTISGLPPTVTVPEGDTARLL-------C-VVA 1157

  Fly   252 YPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARV 316
            .....|.|:::.:.:..:.|       ...:..|.||.:..:..|..|.|.|.| .:..:|.:| 
Human  1158 GESVNIRWSRNGLPVQADGH-------RVHQSPDGTLLIYNLRARDEGSYTCSA-YQGSQAVSR- 1213

  Fly   317 NLFETIIPVCPPA 329
               .|.:.|..||
Human  1214 ---STEVKVVSPA 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 28/104 (27%)
FR1 37..50 CDD:409353 2/7 (29%)
Ig strand A' 37..42 CDD:409353 83/338 (25%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 3/7 (43%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 1/13 (8%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 12/42 (29%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 5/18 (28%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 25/100 (25%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 19/90 (21%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767
Ig 914..>978 CDD:325142 21/70 (30%)
I-set 1049..1119 CDD:254352 25/69 (36%)
IG 1139..1219 CDD:214652 21/99 (21%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.