Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352835.1 | Gene: | PAPLN / 89932 | HGNCID: | 19262 | Length: | 1278 | Species: | Homo sapiens |
Alignment Length: | 338 | Identity: | 83/338 - (24%) |
---|---|---|---|
Similarity: | 123/338 - (36%) | Gaps: | 87/338 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 IGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQET 106
Fly 107 DAGTYTC------------QV-VISTVHKVSAEVKLS---VRRPPV------------------- 136
Fly 137 --------ISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKS 193
Fly 194 VKKEDRGTYYCVADNGVSKGDRRNINVEV-------EFAPVITVPRPRLGQALQYDMDLECHIEA 251
Fly 252 YPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARV 316
Fly 317 NLFETIIPVCPPA 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 28/104 (27%) |
FR1 | 37..50 | CDD:409353 | 2/7 (29%) | ||
Ig strand A' | 37..42 | CDD:409353 | 83/338 (25%) | ||
Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
CDR1 | 51..59 | CDD:409353 | 3/7 (43%) | ||
Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
CDR2 | 67..81 | CDD:409353 | 1/13 (8%) | ||
Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 12/42 (29%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 108..115 | CDD:409353 | 5/18 (28%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig_3 | 134..208 | CDD:404760 | 25/100 (25%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
Ig | 227..318 | CDD:416386 | 19/90 (21%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
PAPLN | NP_001352835.1 | TSP1 | 29..80 | CDD:214559 | |
ADAM_spacer1 | 183..298 | CDD:310520 | |||
TSP1 | 308..361 | CDD:214559 | |||
TSP1 | 369..424 | CDD:214559 | |||
TSP1 | 424..481 | CDD:214559 | |||
TSP1 | 488..539 | CDD:214559 | |||
Kunitz_BPTI | 753..805 | CDD:278443 | |||
Papilin_u7 | 814..905 | CDD:318767 | |||
Ig | 914..>978 | CDD:325142 | 21/70 (30%) | ||
I-set | 1049..1119 | CDD:254352 | 25/69 (36%) | ||
IG | 1139..1219 | CDD:214652 | 21/99 (21%) | ||
PLAC | 1235..1267 | CDD:312271 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |