| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011541328.1 | Gene: | KIRREL3 / 84623 | HGNCID: | 23204 | Length: | 809 | Species: | Homo sapiens |
| Alignment Length: | 266 | Identity: | 61/266 - (22%) |
|---|---|---|---|
| Similarity: | 103/266 - (38%) | Gaps: | 63/266 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 ISNCVWSTLLLAIFVQQTLAQRT------PTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLK 64
Fly 65 TDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKL 129
Fly 130 SVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTP-TITWRRENNAILPTDSATY--------- 184
Fly 185 -VGNTLRIKSVKKEDRGTYY-CVADNGVSKGD------------RRNINVEVEFAPVITVPRPRL 235
Fly 236 GQALQY 241 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 21/94 (22%) |
| FR1 | 37..50 | CDD:409353 | 3/12 (25%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
| CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
| Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 1/1 (100%) | ||
| FR3 | 84..115 | CDD:409353 | 7/30 (23%) | ||
| Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
| FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..208 | CDD:404760 | 27/85 (32%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409353 | 3/5 (60%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 1/15 (7%) | ||
| Ig strand C | 256..260 | CDD:409353 | |||
| Ig strand E | 286..290 | CDD:409353 | |||
| Ig strand F | 300..305 | CDD:409353 | |||
| KIRREL3 | XP_011541328.1 | Ig | 58..149 | CDD:299845 | |
| IG_like | 60..149 | CDD:214653 | |||
| I-set | 156..249 | CDD:254352 | |||
| Ig2_KIRREL3-like | 171..252 | CDD:143236 | |||
| Ig_2 | 260..337 | CDD:290606 | 6/24 (25%) | ||
| I-set | 341..422 | CDD:254352 | 22/101 (22%) | ||
| IGc2 | 355..406 | CDD:197706 | 14/71 (20%) | ||
| Ig5_KIRREL3 | 424..521 | CDD:143306 | 28/98 (29%) | ||
| IG_like | 432..521 | CDD:214653 | 22/88 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||