| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070212.1 | Gene: | zgc:152904 / 767777 | ZFINID: | ZDB-GENE-060929-856 | Length: | 809 | Species: | Danio rerio |
| Alignment Length: | 257 | Identity: | 64/257 - (24%) |
|---|---|---|---|
| Similarity: | 115/257 - (44%) | Gaps: | 38/257 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 92 NSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQME 156
Fly 157 CYASGYPTPTITWRRENNAILPTDS-----------ATYVGNTLRIKSVKKEDRGTYYCVADNGV 210
Fly 211 SKGDRRNINVEVEFAPVITVPRPRLGQALQYD-----MDLECHIEAYPPPAIVWTKDDIQLANNQ 270
Fly 271 HYSISHFATAD---EYTD--STLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCP 327 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 10/38 (26%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | 9/22 (41%) | ||
| Ig strand D | 84..90 | CDD:409353 | |||
| Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 0/7 (0%) | ||
| FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig_3 | 134..208 | CDD:404760 | 25/84 (30%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 22/100 (22%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| zgc:152904 | NP_001070212.1 | Ig | 1..81 | CDD:299845 | |
| IG_like | 2..80 | CDD:214653 | |||
| IGc2 | 97..158 | CDD:197706 | |||
| Ig | 177..273 | CDD:299845 | 11/41 (27%) | ||
| I-set | 184..270 | CDD:254352 | 10/38 (26%) | ||
| Ig | 272..369 | CDD:299845 | 26/99 (26%) | ||
| I-set | 274..367 | CDD:254352 | 26/95 (27%) | ||
| IG_like | 385..462 | CDD:214653 | 19/84 (23%) | ||
| IGc2 | 386..454 | CDD:197706 | 18/75 (24%) | ||
| FN3 | 468..561 | CDD:238020 | 2/4 (50%) | ||
| fn3 | <591..650 | CDD:278470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12231 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||