DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and DIP-epsilon

DIOPT Version :10

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:303 Identity:89/303 - (29%)
Similarity:145/303 - (47%) Gaps:28/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSS--TYKLQIKDIQE 105
            |..|:..|||:....|.|.::..:...: |:..:.::.::.|.|:.:|.:..  |:.|.|.::||
  Fly    66 GRNVKLACSVKNLGSYKVAWMHFEQSAI-LTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQE 129

  Fly   106 TDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQS-VVASEGSEVQMECYASGYPTPTITW 169
            .|.|.|.||:...|.......||:.|  ||.|.|..|.| ::..||..|.:.|.|.|.|.|||.|
  Fly   130 EDRGRYMCQINTVTAKTQYGFVKVVV
--PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKW 192

  Fly   170 RREN-NAI----------LPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVE 223
            :|:: |.|          |.|||       |.::.:.:...|.|.|:|.|||.....:.|.|.|:
  Fly   193 KRDDGNKIVINKTLEVHDLETDS-------LELERISRLHMGAYLCIASNGVPPSVSKRIKVSVD 250

  Fly   224 FAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKD-DIQLANNQHYSISHFATADEYTDST 287
            |:|::.:|...:|..:.:::.|||.|||.|.....||:: |..:..:..|..........| .:|
  Fly   251 FSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSY-KAT 314

  Fly   288 LR--VITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPP 328
            :|  :..|:...||:|.|.|.|..|:.:..:.|:.:..|...|
  Fly   315 MRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 24/89 (27%)
Ig strand B 46..50 CDD:409381 1/3 (33%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 29/85 (34%)
Ig 227..318 CDD:472250 24/93 (26%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/5 (40%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 24/89 (27%)
Ig strand B 69..73 CDD:409353 1/3 (33%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 2/6 (33%)
Ig 157..249 CDD:472250 33/98 (34%)
Ig strand B 176..180 CDD:409289 1/3 (33%)
Ig strand C 189..193 CDD:409289 2/3 (67%)
Ig strand E 213..218 CDD:409289 4/11 (36%)
Ig strand F 228..233 CDD:409289 2/4 (50%)
Ig strand G 242..245 CDD:409289 0/2 (0%)
IG_like 267..348 CDD:214653 22/81 (27%)
Ig strand C 283..287 CDD:409394 0/3 (0%)
Ig strand E 313..319 CDD:409394 2/5 (40%)
Ig strand F 329..334 CDD:409394 2/4 (50%)

Return to query results.
Submit another query.