DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and CEACAM1

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001703.2 Gene:CEACAM1 / 634 HGNCID:1814 Length:526 Species:Homo sapiens


Alignment Length:229 Identity:57/229 - (24%)
Similarity:85/229 - (37%) Gaps:40/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSA----EVKLSVRRPPVISDNSTQSVVASEGS 151
            ||:|   |.|:::.:.|.|.||.||:.|.:....|    .|...:.:|.:.|:||..   ..:..
Human   103 PNAS---LLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYP
ELPKPSISSNNSNP---VEDKD 161

  Fly   152 EVQMECYASGYPTPTITWRRENNAILPTDSATYVGN---TLRIKSVKKEDRGTYYCVADNGVSKG 213
            .|...|......|..:.|  .||..||......:.|   ||.:.||.:.|.|.|.|...|.||..
Human   162 AVAFTCEPETQDTTYLWW--INNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSAN 224

  Fly   214 DRRNINVEVEFAPVITVPRPRLGQALQY-----DMDLECHIEAYPPPAIVWTKDDIQLANNQHYS 273
            ....:.:.|.:.|    ..|.:..:..|     ::.|.|:..:.||....|..:.....:.|...
Human   225 RSDPVTLNVTYGP----DTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELF 285

  Fly   274 ISHFATADEYTDSTLRVITVEKRQYGDYVCKATN 307
            |.:              |||...  |.|.|.|.|
Human   286 IPN--------------ITVNNS--GSYTCHANN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 14/43 (33%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353
Ig strand C' 68..72 CDD:409353
Ig strand C' 79..81 CDD:409353
FR3 84..115 CDD:409353 9/23 (39%)
Ig strand D 84..90 CDD:409353
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 2/9 (22%)
Ig strand G 124..130 CDD:409353 2/9 (22%)
Ig_3 134..208 CDD:404760 21/76 (28%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 3/6 (50%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 17/86 (20%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
CEACAM1NP_001703.2 Ig_CEACAM_D1 36..140 CDD:143251 13/39 (33%)
Required for homophilic binding. /evidence=ECO:0000250|UniProtKB:P16573 39..142 14/41 (34%)
Ig_CEACAM_D4 146..233 CDD:143217 24/91 (26%)
IG_like 157..233 CDD:214653 20/77 (26%)
Ig_2 240..318 CDD:290606 17/80 (21%)
IG_like 244..304 CDD:214653 16/76 (21%)
I-set 317..408 CDD:254352
Ig 340..415 CDD:299845
DUF4690 <419..451 CDD:292384
Interaction with calmodulin. /evidence=ECO:0000250|UniProtKB:P16573 450..462
Interaction with FLNA. /evidence=ECO:0000250|UniProtKB:P16573 452..526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 461..513
Required for interaction with PTPN11 and PTPN6 and for control of phosphorylation level. /evidence=ECO:0000250|UniProtKB:P31809 489..526
Essential for interaction with PTPN11 and PTPN6. /evidence=ECO:0000250|UniProtKB:P31809 520..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.