DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and IGDCC4

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_016877937.1 Gene:IGDCC4 / 57722 HGNCID:13770 Length:1264 Species:Homo sapiens


Alignment Length:359 Identity:90/359 - (25%)
Similarity:131/359 - (36%) Gaps:57/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LAIFVQQTLAQRTPTI---SYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGST 77
            |.:...||...:..|:   |...:.|..:..||..|:|.::   ......:..:.|.|.|.....
Human   140 LGVLASQTAVVKLATLADFSLHPESQTVEENGTARFECHIE---GLPAPIITWEKDQVTLPEEPR 201

  Fly    78 LVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNST 142
            |::.         ||.   .|||.|:||:|||.|.|....|.....|.|..|||.....::....
Human   202 LIVL---------PNG---VLQILDVQESDAGPYRCVATNSARQHFSQEALLSVAHRGSLASTRG 254

  Fly   143 QSVV---ASE------GSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKED 198
            |.||   |.|      |..|.|||.||..|||.::|.|::...:.||........|.|.:.:...
Human   255 QDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIANAQPWH 319

  Fly   199 RGTYYCVADNGVSKGDRRNI-----NVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIV 258
            .|.|.|.|    :|...|:.     .:.|..||.||.....|.:.........|.....|.||:.
Human   320 SGVYVCRA----NKPRTRDFATAAAELRVLAAPAITQAPEALSRTRASTARFVCRASGEPRPALR 380

  Fly   259 WTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETI- 322
            |..:...|..|....:       :....:|.:..:..:..|.|.|.|.|..|.|.|..:|...: 
Human   381 WLHNGAPLRPNGRVKV-------QGGGGSLVITQIGLQDAGYYQCVAENSAGMACAAASLAVVVR 438

  Fly   323 --IPVCPPACGQAYIAGAEDVSATSFALVGILAA 354
              :|..|..           |:||..:...:|.|
Human   439 EGLPSAPTR-----------VTATPLSSSAVLVA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 26/94 (28%)
FR1 37..50 CDD:409353 4/12 (33%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 3/6 (50%)
CDR1 51..59 CDD:409353 0/7 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 4/13 (31%)
Ig strand C' 68..72 CDD:409353 2/3 (67%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 13/30 (43%)
Ig strand D 84..90 CDD:409353 0/5 (0%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 2/5 (40%)
Ig strand G 124..130 CDD:409353 2/5 (40%)
Ig_3 134..208 CDD:404760 25/82 (30%)
Ig strand B 153..157 CDD:409353 2/3 (67%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 19/90 (21%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
IGDCC4XP_016877937.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.