Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 315 | Identity: | 89/315 - (28%) |
---|---|---|---|
Similarity: | 146/315 - (46%) | Gaps: | 31/315 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 AQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRY 89
Fly 90 DPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISD--NSTQSVVASEGSE 152
Fly 153 VQMECYASGYPTPTITWRRENNAILPTDS----ATYVGNTLRIKSVKKEDRGTYYCVADNGVSKG 213
Fly 214 DRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFA 278
Fly 279 TADEYTDSTLRV---ITVEKRQYGD---YVCKATNRFGEAEARVNLFETIIPVCP 327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 22/94 (23%) |
FR1 | 37..50 | CDD:409353 | 1/12 (8%) | ||
Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 1/13 (8%) | ||
Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 10/30 (33%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig_3 | 134..208 | CDD:404760 | 25/79 (32%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 27/96 (28%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 300..305 | CDD:409353 | 3/7 (43%) | ||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 24/103 (23%) |
Ig | 145..238 | CDD:416386 | 28/92 (30%) | ||
Ig strand A | 145..149 | CDD:409353 | 2/3 (67%) | ||
Ig strand A' | 154..159 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 178..183 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 1/7 (14%) | ||
Ig | 242..333 | CDD:416386 | 28/97 (29%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/10 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
Ig strand F | 314..322 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 325..334 | CDD:409353 | 3/8 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 1 | 1.000 | - | - | otm40772 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12231 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
7 | 6.920 |