Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326058.1 | Gene: | obscnb / 572412 | ZFINID: | ZDB-GENE-070119-5 | Length: | 6781 | Species: | Danio rerio |
Alignment Length: | 315 | Identity: | 76/315 - (24%) |
---|---|---|---|
Similarity: | 124/315 - (39%) | Gaps: | 59/315 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 FVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDS 83
Fly 84 RFSLRYDPNSSTYKLQIKDIQETDAGTYTCQV--VISTVHKVSAEVKLSVRRPPVISDNSTQSVV 146
Fly 147 ASEGSEVQMECYAS--GYPTPTITWRRENNAILPTDSATY----VGNT--LRIKSVKKEDRGTYY 203
Fly 204 CVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIE-AYPPPAIVWTKDDIQLA 267
Fly 268 NNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETI 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 21/96 (22%) |
FR1 | 37..50 | CDD:409353 | 4/12 (33%) | ||
Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 44..51 | CDD:409353 | 2/6 (33%) | ||
CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 68..72 | CDD:409353 | 2/3 (67%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 8/30 (27%) | ||
Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
Ig_3 | 134..208 | CDD:404760 | 25/81 (31%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 23/91 (25%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 300..305 | CDD:409353 | 3/4 (75%) | ||
obscnb | XP_021326058.1 | I-set | 10..99 | CDD:254352 | |
I-set | 110..199 | CDD:254352 | |||
I-set | 282..362 | CDD:333254 | |||
I-set | 369..452 | CDD:333254 | |||
I-set | 459..>523 | CDD:333254 | |||
FN3 | 547..634 | CDD:238020 | |||
Ig | 762..809 | CDD:319273 | |||
IG | 836..901 | CDD:214652 | |||
I-set | 928..997 | CDD:333254 | |||
I-set | 1020..1089 | CDD:333254 | |||
I-set | 1112..1181 | CDD:333254 | |||
I-set | 1204..1273 | CDD:333254 | |||
I-set | 1296..1365 | CDD:333254 | |||
Ig | 1401..1469 | CDD:319273 | |||
I-set | 1483..1552 | CDD:333254 | |||
Ig | 1585..1644 | CDD:319273 | |||
Ig | 1689..1732 | CDD:319273 | |||
I-set | 1750..1833 | CDD:333254 | |||
I-set | 1840..1923 | CDD:254352 | |||
I-set | 1930..1999 | CDD:333254 | |||
I-set | 2018..2091 | CDD:333254 | |||
I-set | 2107..2190 | CDD:333254 | |||
I-set | 2196..2279 | CDD:333254 | |||
I-set | 2285..2368 | CDD:333254 | |||
I-set | 2374..2458 | CDD:333254 | |||
I-set | 2464..2547 | CDD:333254 | |||
I-set | 2553..>2620 | CDD:333254 | |||
I-set | 2643..2725 | CDD:333254 | |||
I-set | 2732..2815 | CDD:333254 | |||
I-set | 2820..2905 | CDD:333254 | |||
I-set | 2912..2995 | CDD:333254 | |||
IG_like | 3007..3084 | CDD:214653 | |||
I-set | 3090..3160 | CDD:333254 | |||
I-set | 3178..3260 | CDD:333254 | |||
I-set | 3266..3349 | CDD:333254 | |||
IG_like | 3389..>3452 | CDD:214653 | 16/75 (21%) | ||
I-set | 3471..3541 | CDD:333254 | 22/74 (30%) | ||
I-set | 3560..3630 | CDD:333254 | 19/75 (25%) | ||
I-set | 3649..3719 | CDD:333254 | 0/1 (0%) | ||
I-set | 3739..3808 | CDD:333254 | |||
I-set | 3828..3910 | CDD:333254 | |||
IG | 3926..4000 | CDD:214652 | |||
I-set | 4007..4090 | CDD:254352 | |||
I-set | 4095..>4162 | CDD:333254 | |||
I-set | 4186..4269 | CDD:254352 | |||
I-set | 4275..4358 | CDD:333254 | |||
IG | 4370..4449 | CDD:214652 | |||
IG_like | 4461..4538 | CDD:214653 | |||
I-set | 4636..>4700 | CDD:333254 | |||
FN3 | 4725..4818 | CDD:238020 | |||
I-set | 4825..4906 | CDD:333254 | |||
IQ | 5065..5087 | CDD:197470 | |||
I-set | 5104..5177 | CDD:254352 | |||
I-set | 5331..5421 | CDD:254352 | |||
I-set | 5469..5559 | CDD:254352 | |||
I-set | 5583..5678 | CDD:333254 | |||
SH3_Obscurin_like | 5807..5869 | CDD:212958 | |||
RhoGEF | 5899..6075 | CDD:321997 | |||
PH_Obscurin | 6084..6208 | CDD:270059 | |||
I-set | 6216..6308 | CDD:254352 | |||
I-set | 6310..6399 | CDD:333254 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |