Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334866.1 | Gene: | dscama / 568643 | ZFINID: | ZDB-GENE-050310-7 | Length: | 2025 | Species: | Danio rerio |
Alignment Length: | 261 | Identity: | 73/261 - (27%) |
---|---|---|---|
Similarity: | 110/261 - (42%) | Gaps: | 51/261 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 DSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEV--KLSVRRP--PVISDNST 142
Fly 143 QSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKE---------- 197
Fly 198 DRGTYYCVADNGVSKGDRRNINVEVEFAPVITVP-RPRLGQALQYD-------MDLECHIEAYPP 254
Fly 255 PAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEA--EARVN 317
Fly 318 L 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 18/50 (36%) |
FR1 | 37..50 | CDD:409353 | |||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | |||
CDR1 | 51..59 | CDD:409353 | |||
Ig strand C | 59..63 | CDD:409353 | |||
FR2 | 60..63 | CDD:409353 | |||
CDR2 | 67..81 | CDD:409353 | |||
Ig strand C' | 68..72 | CDD:409353 | |||
Ig strand C' | 79..81 | CDD:409353 | |||
FR3 | 84..115 | CDD:409353 | 10/30 (33%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 3/7 (43%) | ||
Ig strand G | 124..130 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 134..208 | CDD:404760 | 21/85 (25%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 187..191 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
Ig | 227..318 | CDD:416386 | 30/100 (30%) | ||
Ig strand C | 256..260 | CDD:409353 | 2/3 (67%) | ||
Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
dscama | XP_021334866.1 | Ig | 124..217 | CDD:325142 | |
I-set | 236..311 | CDD:254352 | 18/50 (36%) | ||
IG_like | 321..402 | CDD:214653 | 20/95 (21%) | ||
I-set | 408..502 | CDD:333254 | 28/93 (30%) | ||
IGc2 | 524..579 | CDD:197706 | |||
Ig | 614..679 | CDD:319273 | |||
Ig_DSCAM | 708..787 | CDD:143211 | |||
Ig | 805..898 | CDD:325142 | |||
FN3 | 894..988 | CDD:238020 | |||
FN3 | 995..1092 | CDD:238020 | |||
fn3 | 1100..1186 | CDD:306538 | |||
fn3 | 1199..1282 | CDD:306538 | |||
Ig | 1312..1377 | CDD:319273 | |||
fn3 | 1405..1471 | CDD:306538 | |||
FN3 | 1492..1563 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |