| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002776.3 | Gene: | PSG11 / 5680 | HGNCID: | 9516 | Length: | 335 | Species: | Homo sapiens |
| Alignment Length: | 379 | Identity: | 70/379 - (18%) |
|---|---|---|---|
| Similarity: | 120/379 - (31%) | Gaps: | 110/379 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 PSISNCVWSTLLLAIFV----------QQTLAQRTPTIS------------------YITQE-QI 39
Fly 40 KDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTY---KLQIK 101
Fly 102 DIQETDAGTYTCQVV------ISTVHKVSAEVKLSVRRPPVISDN-----STQSVVASEGSEVQM 155
Fly 156 ECYASGYPTPTITWRRENNAILPTD--SATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNI 218
Fly 219 NVEVEFAPVITVPRPRLGQAL-QY----DMDLECHIEAYPPPAIVWT-KDDIQLANNQHYSISHF 277
Fly 278 ATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACG 331 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 17/104 (16%) |
| FR1 | 37..50 | CDD:409353 | 3/13 (23%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 1/13 (8%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 9/33 (27%) | ||
| Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 94..102 | CDD:409353 | 3/10 (30%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 0/13 (0%) | ||
| FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig_3 | 134..208 | CDD:404760 | 15/80 (19%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 19/96 (20%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| PSG11 | NP_002776.3 | Ig_CEACAM_D1 | 36..138 | CDD:143251 | 20/128 (16%) |
| IG_like | 45..>121 | CDD:214653 | 17/102 (17%) | ||
| Cell attachment site. /evidence=ECO:0000255 | 127..129 | 0/1 (0%) | |||
| Ig | 148..236 | CDD:299845 | 17/96 (18%) | ||
| IG_like | 163..223 | CDD:214653 | 13/68 (19%) | ||
| Ig_2 | 242..320 | CDD:290606 | 22/96 (23%) | ||
| IG_like | 246..318 | CDD:214653 | 18/90 (20%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||