DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and PSG5

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001123486.1 Gene:PSG5 / 5673 HGNCID:9522 Length:335 Species:Homo sapiens


Alignment Length:396 Identity:74/396 - (18%)
Similarity:127/396 - (32%) Gaps:142/396 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSISNCVWSTLLLA----------IFVQQTLAQRTPTIS------YITQEQIKDIGGTVEFDCSV 52
            |...:..|..|||.          |..|.|:....|.:|      .:.....:::.|.:.:...:
Human     8 PCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQL 72

  Fly    53 QYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSL---RYDPNSSTY---KLQIKDIQETDAGTY 111
            .....|                 .|..:.|.:.::   .|....:.|   .|.|:::...|||:|
Human    73 MDLYHY-----------------ITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY 120

  Fly   112 TCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGY---------PTPTI 167
            |..:               ::|     .:.|:.|              :||         |.|.|
Human   121 TLHI---------------IKR-----GDRTRGV--------------TGYFTFNLYLKLPKPYI 151

  Fly   168 TWR----RENNAIL------PTDSATYV----GNTL----RIK-----------SVKKEDRGTYY 203
            |..    |||..:|      .:::.||:    |.:|    |:|           ||.:.:.|.|.
Human   152 TINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYE 216

  Fly   204 C-VAD-NGVSKGDRRNINVEVEFAPVITVPRPRLGQALQY-----DMDLECHIEAYPPPAIVWTK 261
            | :.| :|..:.|...:|  |.:.|.:    |.:..:..|     ::.|.|..|:.||....||.
Human   217 CEIRDRDGGMRSDPVTLN--VLYGPDL----PSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTI 275

  Fly   262 DDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVC 326
            :.....:.|..||....|                :..|.|.|...|.....|:..::  |:....
Human   276 NGKFQQSGQKLSIPQITT----------------KHRGLYTCSVRNSATGKESSKSM--TVEVSA 322

  Fly   327 PPACGQ 332
            |...|:
Human   323 PSGIGR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 13/100 (13%)
FR1 37..50 CDD:409353 1/12 (8%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 0/7 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 1/13 (8%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 9/36 (25%)
Ig strand D 84..90 CDD:409353 0/8 (0%)
Ig strand E 94..102 CDD:409353 3/10 (30%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 0/7 (0%)
FR4 124..130 CDD:409353 0/5 (0%)
Ig strand G 124..130 CDD:409353 0/5 (0%)
Ig_3 134..208 CDD:404760 24/113 (21%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 187..191 CDD:409353 1/7 (14%)
Ig strand F 201..206 CDD:409353 2/5 (40%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 18/95 (19%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
PSG5NP_001123486.1 Ig_CEACAM_D1 36..138 CDD:143251 20/152 (13%)
Cell attachment site. /evidence=ECO:0000255 127..129 1/6 (17%)
Ig 148..236 CDD:299845 22/89 (25%)
IG_like 167..235 CDD:214653 15/69 (22%)
Ig_2 242..320 CDD:290606 19/95 (20%)
IG_like 246..320 CDD:214653 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.