Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123486.1 | Gene: | PSG5 / 5673 | HGNCID: | 9522 | Length: | 335 | Species: | Homo sapiens |
Alignment Length: | 396 | Identity: | 74/396 - (18%) |
---|---|---|---|
Similarity: | 127/396 - (32%) | Gaps: | 142/396 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 PSISNCVWSTLLLA----------IFVQQTLAQRTPTIS------YITQEQIKDIGGTVEFDCSV 52
Fly 53 QYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSL---RYDPNSSTY---KLQIKDIQETDAGTY 111
Fly 112 TCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGY---------PTPTI 167
Fly 168 TWR----RENNAIL------PTDSATYV----GNTL----RIK-----------SVKKEDRGTYY 203
Fly 204 C-VAD-NGVSKGDRRNINVEVEFAPVITVPRPRLGQALQY-----DMDLECHIEAYPPPAIVWTK 261
Fly 262 DDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVC 326
Fly 327 PPACGQ 332 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 13/100 (13%) |
FR1 | 37..50 | CDD:409353 | 1/12 (8%) | ||
Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
CDR2 | 67..81 | CDD:409353 | 1/13 (8%) | ||
Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 9/36 (25%) | ||
Ig strand D | 84..90 | CDD:409353 | 0/8 (0%) | ||
Ig strand E | 94..102 | CDD:409353 | 3/10 (30%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 0/7 (0%) | ||
FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
Ig_3 | 134..208 | CDD:404760 | 24/113 (21%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/7 (14%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/5 (40%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 18/95 (19%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
PSG5 | NP_001123486.1 | Ig_CEACAM_D1 | 36..138 | CDD:143251 | 20/152 (13%) |
Cell attachment site. /evidence=ECO:0000255 | 127..129 | 1/6 (17%) | |||
Ig | 148..236 | CDD:299845 | 22/89 (25%) | ||
IG_like | 167..235 | CDD:214653 | 15/69 (22%) | ||
Ig_2 | 242..320 | CDD:290606 | 19/95 (20%) | ||
IG_like | 246..320 | CDD:214653 | 18/91 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |