Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_112536.2 | Gene: | PSG2 / 5670 | HGNCID: | 9519 | Length: | 335 | Species: | Homo sapiens |
Alignment Length: | 384 | Identity: | 75/384 - (19%) |
---|---|---|---|
Similarity: | 120/384 - (31%) | Gaps: | 120/384 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 PSISNCVWSTLL----------LAIFVQQTLAQRTPTIS------------------YITQE-QI 39
Fly 40 KDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQ 104
Fly 105 ETDAGTYTCQVV------ISTVHKVSAEVKLSVRRPPVISDN-----STQSVVAS---EGSEVQM 155
Fly 156 ECYASGYPTPTITWR---RENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRN 217
Fly 218 INVEVEFAPVITVPRP-----RLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHF 277
Fly 278 ATADEYTDSTLRVITVEKRQYGDYVCKATN-RFGE-----------AEARVNLFETIIP 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 19/101 (19%) |
FR1 | 37..50 | CDD:409353 | 3/13 (23%) | ||
Ig strand A' | 37..42 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 2/13 (15%) | ||
Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 10/30 (33%) | ||
Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 0/13 (0%) | ||
FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
Ig_3 | 134..208 | CDD:404760 | 18/84 (21%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 22/107 (21%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 300..305 | CDD:409353 | 3/4 (75%) | ||
PSG2 | NP_112536.2 | Ig_CEACAM_D1 | 36..138 | CDD:143251 | 23/125 (18%) |
IG_like | 45..>121 | CDD:214653 | 19/99 (19%) | ||
Ig | 148..236 | CDD:299845 | 20/100 (20%) | ||
Ig_2 | 242..320 | CDD:290606 | 20/97 (21%) | ||
IG_like | 246..318 | CDD:214653 | 20/91 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |