| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005169942.1 | Gene: | paplna / 562930 | ZFINID: | ZDB-GENE-070815-4 | Length: | 1187 | Species: | Danio rerio |
| Alignment Length: | 303 | Identity: | 66/303 - (21%) |
|---|---|---|---|
| Similarity: | 98/303 - (32%) | Gaps: | 103/303 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 SVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDP-----NSSTYKLQ----------- 99
Fly 100 --------------------------IKDIQETDAGTYTCQVVIS---TVHKVSAEV--KLSVRR 133
Fly 134 PPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVG--NTLRIKSVKK 196
Fly 197 EDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMD---------------LE 246
Fly 247 CHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLR 289 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 27/126 (21%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | 66/303 (22%) | ||
| CDR1 | 51..59 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 15/72 (21%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 94..102 | CDD:409353 | 5/44 (11%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 0/10 (0%) | ||
| FR4 | 124..130 | CDD:409353 | 1/7 (14%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 134..208 | CDD:404760 | 22/75 (29%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 14/78 (18%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/4 (50%) | ||
| Ig strand F | 300..305 | CDD:409353 | |||
| paplna | XP_005169942.1 | TSP1 | 24..75 | CDD:214559 | |
| ADAM_spacer1 | 181..293 | CDD:310520 | |||
| TSP1 | 303..356 | CDD:214559 | |||
| TSP1 | 388..442 | CDD:214559 | |||
| TSP1 | 449..498 | CDD:214559 | |||
| TSP1 | 504..557 | CDD:214559 | |||
| KU | 720..771 | CDD:238057 | |||
| Ig_3 | 839..906 | CDD:316449 | |||
| IGc2 | 960..1022 | CDD:197706 | 12/61 (20%) | ||
| I-set | 1039..1121 | CDD:333254 | 25/98 (26%) | ||
| PLAC | 1142..1173 | CDD:312271 | 5/41 (12%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||