| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_689255.3 | Gene: | robo4 / 560765 | ZFINID: | ZDB-GENE-020809-1 | Length: | 1134 | Species: | Danio rerio |
| Alignment Length: | 308 | Identity: | 71/308 - (23%) |
|---|---|---|---|
| Similarity: | 123/308 - (39%) | Gaps: | 48/308 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 PTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLK------TD-----SDPVFLSTGSTLVIKD 82
Fly 83 SRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVA 147
Fly 148 SEGSEVQMECYAS-GYPTPTITWRRENNAI-LPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGV 210
Fly 211 SKGDRRNINVEVEFAPVITVPRP-----RLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQ 270
Fly 271 HYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 18/105 (17%) |
| FR1 | 37..50 | CDD:409353 | 1/12 (8%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 5/13 (38%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 5/30 (17%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 94..102 | CDD:409353 | 0/7 (0%) | ||
| Ig strand F | 108..115 | CDD:409353 | 2/6 (33%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 22/75 (29%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 23/95 (24%) | ||
| Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| robo4 | XP_689255.3 | Ig1_Robo | 70..169 | CDD:143317 | 19/106 (18%) |
| I-set | 71..168 | CDD:254352 | 19/105 (18%) | ||
| I-set | 175..261 | CDD:254352 | 25/92 (27%) | ||
| Ig2_Robo | 177..261 | CDD:143201 | 24/90 (27%) | ||
| I-set | 265..350 | CDD:254352 | 25/98 (26%) | ||
| Ig | 282..350 | CDD:299845 | 20/80 (25%) | ||
| FN3 | 373..448 | CDD:214495 | |||
| FN3 | 472..560 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||