DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lac and zgc:171490

DIOPT Version :9

Sequence 1:	NP_523713.2	Gene:	Lac / 36363	FlyBaseID:	FBgn0010238	Length:	359	Species:	Drosophila melanogaster
Sequence 2:	NP_001107058.1	Gene:	zgc:171490 / 558926	ZFINID:	ZDB-GENE-080204-29	Length:	336	Species:	Danio rerio

Alignment Length:	144	Identity:	36/144 - (25%)
Similarity:	56/144 - (38%)	Gaps:	24/144 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    78 LVIKDSRFSLRYDPNSSTYKLQIKDIQET-DAGTYTCQVVISTVHKVSAEVKLSVRRP-PVISDN 140
            |..|:.||..|...:..|..|.|.:|:.. |.|.|  |::|   |..|:..|.::.:. .:.:|.
Zfish    82 LKAKNERFRNRLKLDEETGDLTILNIRTADDTGDY--QLII---HSNSSNNKDNIEKTFRIAADT 141

  Fly   141 S-TQSVVASEGSEV----------QMECYASGYPTPTITWRRE---NNAILP---TDSATYVGNT 188
            | .:|....||..|          :|..|.|......:|..:.   .||...   ||......::
Zfish   142 SEMKSPSVKEGESVTLDPGVNAYNEMSWYFSDILIARLTGNQSQICTNAECKERFTDRLKTENDS 206

  Fly   189 LRIKSVKKEDRGTY 202
            |.|.:.:..|.|.|
Zfish   207 LNITNSRSTDSGEY 220

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lac	NP_523713.2	IG_like	36..131	CDD:214653	17/53 (32%)
		FR1	37..50	CDD:409353
		Ig strand A'	37..42	CDD:409353
		Ig strand B	44..51	CDD:409353
		CDR1	51..59	CDD:409353
		Ig strand C	59..63	CDD:409353
		FR2	60..63	CDD:409353
		CDR2	67..81	CDD:409353	1/2 (50%)
		Ig strand C'	68..72	CDD:409353
		Ig strand C'	79..81	CDD:409353	0/1 (0%)
		FR3	84..115	CDD:409353	10/31 (32%)
		Ig strand D	84..90	CDD:409353	3/5 (60%)
		Ig strand E	94..102	CDD:409353	3/7 (43%)
		Ig strand F	108..115	CDD:409353	2/6 (33%)
		CDR3	116..124	CDD:409353	2/7 (29%)
		FR4	124..130	CDD:409353	2/5 (40%)
		Ig strand G	124..130	CDD:409353	2/5 (40%)
		Ig_3	134..208	CDD:404760	19/87 (22%)
		Ig strand B	153..157	CDD:409353	2/13 (15%)
		Ig strand C	166..170	CDD:409353	1/3 (33%)
		Ig strand E	187..191	CDD:409353	1/3 (33%)
		Ig strand F	201..206	CDD:409353	1/2 (50%)
		Ig strand G	215..218	CDD:409353
		Ig	227..318	CDD:416386
		Ig strand C	256..260	CDD:409353
		Ig strand E	286..290	CDD:409353
		Ig strand F	300..305	CDD:409353
zgc:171490	NP_001107058.1	Ig	36..135	CDD:299845	17/57 (30%)
		Ig	145..240	CDD:299845	17/76 (22%)
		IG_like	145..239	CDD:214653	17/76 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910