| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009297968.1 | Gene: | sdk1a / 558391 | ZFINID: | ZDB-GENE-081104-374 | Length: | 2245 | Species: | Danio rerio |
| Alignment Length: | 282 | Identity: | 64/282 - (22%) |
|---|---|---|---|
| Similarity: | 108/282 - (38%) | Gaps: | 41/282 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 SSTYKLQIKDIQETDAGTYTCQVVI--STVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQM 155
Fly 156 ECYASGYPTPTITWRRENNAILPTDSATY-----VGNTLRIKSVKKEDRGTYYCVADNGVSKGDR 215
Fly 216 RNINVEVEFAPVITVPRPRLGQALQYDMDL----------ECHIEAYPPPAIVWTKDDIQLANNQ 270
Fly 271 HYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETI---IPVCPPACGQ 332
Fly 333 AYIAGAE---DVSATSFALVGI 351 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 12/39 (31%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | 8/21 (38%) | ||
| Ig strand D | 84..90 | CDD:409353 | |||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/9 (22%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 15/78 (19%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 24/100 (24%) | ||
| Ig strand C | 256..260 | CDD:409353 | 3/3 (100%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| sdk1a | XP_009297968.1 | I-set | 125..208 | CDD:254352 | |
| Ig | 125..204 | CDD:299845 | |||
| IG_like | 222..302 | CDD:214653 | |||
| Ig | 236..287 | CDD:299845 | |||
| Ig_3 | 322..394 | CDD:290638 | 8/21 (38%) | ||
| I-set | 323..412 | CDD:254352 | 12/39 (31%) | ||
| I-set | 416..505 | CDD:254352 | 16/90 (18%) | ||
| Ig | 436..500 | CDD:299845 | 14/65 (22%) | ||
| I-set | 510..600 | CDD:254352 | 26/105 (25%) | ||
| Ig | 527..600 | CDD:299845 | 22/78 (28%) | ||
| I-set | 605..693 | CDD:254352 | 7/31 (23%) | ||
| Ig | 610..693 | CDD:299845 | 6/26 (23%) | ||
| FN3 | 697..788 | CDD:238020 | |||
| fn3 | 800..886 | CDD:278470 | |||
| FN3 | 901..997 | CDD:238020 | |||
| FN3 | 1002..1090 | CDD:238020 | |||
| FN3 | 1100..1196 | CDD:238020 | |||
| FN3 | 1206..1301 | CDD:238020 | |||
| FN3 | 1308..1397 | CDD:238020 | |||
| FN3 | 1408..1501 | CDD:238020 | |||
| FN3 | 1507..1602 | CDD:238020 | |||
| FN3 | 1616..1722 | CDD:238020 | |||
| FN3 | 1732..1825 | CDD:238020 | |||
| FN3 | 1830..1919 | CDD:238020 | |||
| FN3 | 1931..2021 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||