Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005155702.1 | Gene: | igsf9a / 557459 | ZFINID: | ZDB-GENE-060503-288 | Length: | 1619 | Species: | Danio rerio |
Alignment Length: | 287 | Identity: | 74/287 - (25%) |
---|---|---|---|
Similarity: | 121/287 - (42%) | Gaps: | 38/287 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 AKEYNVLFLKTDSD-PVFLSTGSTLVIKDSRFSLRYDPNSSTY---KLQIKDIQETDAGTYTCQV 115
Fly 116 --VISTVHKVSAE---VKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNA 175
Fly 176 ILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNI-NVEVEFAPVITVPRPRLGQAL 239
Fly 240 QYDMDLECHIEAYPP-PAIVWTKDDIQLANNQHYSISHFATADE-YTDSTLRVITVEKRQYGDYV 302
Fly 303 CKATNRFGEAEARVNLFETIIPVCPPA 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 19/84 (23%) |
FR1 | 37..50 | CDD:409353 | |||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | |||
CDR1 | 51..59 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
CDR2 | 67..81 | CDD:409353 | 4/14 (29%) | ||
Ig strand C' | 68..72 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 11/33 (33%) | ||
Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 94..102 | CDD:409353 | 3/10 (30%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 0/8 (0%) | ||
Ig strand G | 124..130 | CDD:409353 | 0/8 (0%) | ||
Ig_3 | 134..208 | CDD:404760 | 23/73 (32%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 3/3 (100%) | ||
Ig strand E | 187..191 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 22/92 (24%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
igsf9a | XP_005155702.1 | IG_like | 27..110 | CDD:214653 | 16/62 (26%) |
Ig | 35..111 | CDD:299845 | 17/63 (27%) | ||
I-set | 140..221 | CDD:254352 | 23/82 (28%) | ||
IGc2 | 151..212 | CDD:197706 | 20/62 (32%) | ||
Ig | 233..318 | CDD:299845 | 23/99 (23%) | ||
I-set | 233..318 | CDD:254352 | 23/99 (23%) | ||
Ig | <349..402 | CDD:299845 | |||
IG_like | 423..502 | CDD:214653 | |||
Ig | 435..498 | CDD:143165 | |||
FN3 | 507..602 | CDD:238020 | |||
fn3 | 614..696 | CDD:278470 | |||
PHA02666 | 1105..>1312 | CDD:222914 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |