| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018174.2 | Gene: | lrit1a / 553943 | ZFINID: | ZDB-GENE-040924-5 | Length: | 643 | Species: | Danio rerio |
| Alignment Length: | 267 | Identity: | 59/267 - (22%) |
|---|---|---|---|
| Similarity: | 92/267 - (34%) | Gaps: | 73/267 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 90 DPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQ 154
Fly 155 MECYASGYPTPTITWRR------ENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKG 213
Fly 214 DRRNINVEVEFAPVI---TV-PRPRLGQ---------ALQYDMDLECHIEAYPPPAIVWTKDDIQ 265
Fly 266 LANNQHYS----------------ISHFATADEYTD---STLRVITVEKRQYGDYVCKATNRFGE 311
Fly 312 AEARVNL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 11/40 (28%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | 6/24 (25%) | ||
| Ig strand D | 84..90 | CDD:409353 | 59/267 (22%) | ||
| Ig strand E | 94..102 | CDD:409353 | 0/7 (0%) | ||
| Ig strand F | 108..115 | CDD:409353 | 2/6 (33%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
| FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..208 | CDD:404760 | 18/79 (23%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 24/122 (20%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| lrit1a | NP_001018174.2 | leucine-rich repeat | 61..84 | CDD:275378 | |
| LRR_8 | 63..119 | CDD:290566 | |||
| LRR_RI | <77..175 | CDD:238064 | |||
| leucine-rich repeat | 85..108 | CDD:275378 | |||
| LRR_8 | 108..167 | CDD:290566 | |||
| leucine-rich repeat | 109..132 | CDD:275378 | |||
| leucine-rich repeat | 133..156 | CDD:275378 | |||
| leucine-rich repeat | 157..170 | CDD:275378 | |||
| LRRCT | 199..243 | CDD:214507 | 3/16 (19%) | ||
| I-set | 252..343 | CDD:254352 | 25/109 (23%) | ||
| Ig | 259..333 | CDD:299845 | 22/91 (24%) | ||
| fn3 | 448..515 | CDD:278470 | 3/16 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||