DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and KIRREL1

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:374 Identity:94/374 - (25%)
Similarity:150/374 - (40%) Gaps:107/374 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFL----STGSTLVIKDSRFSLRY 89
            ||::...:.|....|..|.|.|             :..::|..|    :.|..| |:|:..| ||
Human   223 PTVTLSIEPQTVQEGERVVFTC-------------QATANPEILGYRWAKGGFL-IEDAHES-RY 272

  Fly    90 DPNSSTYKLQIKDIQETDAGTYT----CQV-------VISTVHKVSAEVKLSVRRPPVISDNSTQ 143
            :.|             .|...:|    |:|       .:||:..|....::.|...|..:|    
Human   273 ETN-------------VDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTD---- 320

  Fly   144 SVVASEGSEVQMECYASGYPTPTITWRRENNAILPTD---------SATYVGNT--LRIKSVKKE 197
                 .||:|.:.|...|.|..|:||.::::.:.|..         ||..:.|:  |.:|||.:.
Human   321 -----IGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQVLSNSNQLLLKSVTQA 380

  Fly   198 DRGTYYC---VADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDM-----DLECHIEAYPP 254
            |.|||.|   |...||::   |.:.:.|...|:|:      .:|:||.:     .:||.|.:.||
Human   381 DAGTYTCRAIVPRIGVAE---REVPLYVNGPPIIS------SEAVQYAVRGDGGKVECFIGSTPP 436

  Fly   255 P---AIVWTKDDIQLANNQHYSISHFATADEYTDS---TLRVITVEKRQYGD----YVCKATNRF 309
            |   |..|.::.:::...:.|::       |.|:|   .|..:|:......|    |.|.|.|.|
Human   437 PDRIAWAWKENFLEVGTLERYTV-------ERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSF 494

  Fly   310 GEAEARVNLFE-TIIPVCPPACGQAYIAGAEDVSATSFALVGILAALLF 357
            |...|.:.|.| .::||       ..||||  ....|..|:....||:|
Human   495 GPGTAIIQLEEREVLPV-------GIIAGA--TIGASILLIFFFIALVF 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 22/109 (20%)
FR1 37..50 CDD:409353 4/12 (33%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 0/7 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 4/17 (24%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 7/34 (21%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 0/7 (0%)
Ig strand F 108..115 CDD:409353 2/10 (20%)
CDR3 116..124 CDD:409353 2/7 (29%)
FR4 124..130 CDD:409353 0/5 (0%)
Ig strand G 124..130 CDD:409353 0/5 (0%)
Ig_3 134..208 CDD:404760 25/87 (29%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 187..191 CDD:409353 2/5 (40%)
Ig strand F 201..206 CDD:409353 3/7 (43%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 26/105 (25%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/6 (33%)
Ig strand F 300..305 CDD:409353 3/8 (38%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236
I-set 223..304 CDD:254352 23/108 (21%)
Ig_2 227..305 CDD:290606 21/105 (20%)
Ig_2 311..405 CDD:290606 29/105 (28%)
IG_like 314..405 CDD:214653 28/102 (27%)
Ig5_KIRREL3 407..504 CDD:143306 27/109 (25%)
IG_like 416..504 CDD:214653 24/94 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.