| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017451354.1 | Gene: | Ntm / 50864 | RGDID: | 620958 | Length: | 367 | Species: | Rattus norvegicus |
| Alignment Length: | 352 | Identity: | 90/352 - (25%) |
|---|---|---|---|
| Similarity: | 140/352 - (39%) | Gaps: | 86/352 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 SISNCVWS--TLLLAIFVQQTLAQRTPTISY------ITQEQIKDIGGTVEFDCS-------VQY 54
Fly 55 AKEYNVLFLKTDS---DP--VFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQ 114
Fly 115 VVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPT 179
Fly 180 DSATYVGNT--LRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVIT------VPRPRLG 236
Fly 237 QALQYDMDLECHIEAYPPPAIVWTKDDIQL--------ANNQHYSISHFATADEYTDSTLRVITV 293
Fly 294 EKRQYGDYVCKATNRFGEAEARVNLFE 320 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 23/106 (22%) |
| FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/14 (7%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 6/18 (33%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 3/5 (60%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 7/30 (23%) | ||
| Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 22/75 (29%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 25/104 (24%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Ntm | XP_017451354.1 | Ig | 44..132 | CDD:416386 | 24/109 (22%) |
| Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 51..59 | CDD:409353 | 1/7 (14%) | ||
| CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
| CDR2 | 71..83 | CDD:409353 | 2/11 (18%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 84..118 | CDD:409353 | 13/50 (26%) | ||
| Ig strand D | 87..94 | CDD:409353 | 3/6 (50%) | ||
| Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 110..118 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 119..123 | CDD:409353 | 0/4 (0%) | ||
| Ig strand G | 123..132 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 125..132 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 136..205 | CDD:404760 | 22/74 (30%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 151..160 | CDD:409353 | 1/8 (13%) | ||
| Ig strand F | 197..205 | CDD:409353 | 4/7 (57%) | ||
| Ig | 223..307 | CDD:416386 | 25/102 (25%) | ||
| putative Ig strand A | 223..229 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 239..243 | CDD:409353 | 2/10 (20%) | ||
| Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 278..282 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 292..297 | CDD:409353 | 2/4 (50%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166337179 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 5.850 | |||||